DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and CG1461

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001285238.1 Gene:CG1461 / 32381 FlyBaseID:FBgn0030558 Length:501 Species:Drosophila melanogaster


Alignment Length:549 Identity:126/549 - (22%)
Similarity:217/549 - (39%) Gaps:151/549 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 IKPAAATVSAALQQHQRQQQQYVIRRWKSFLHNNSNNANRRAAKSTATATVTAAATSQRHG--TS 75
            :.|....|..||.:.|.|.|..                  |..:.....|.|::::.:|.|  ..
  Fly    36 VTPNCDVVDQALAELQLQSQDI------------------RKQQDLVDTTATSSSSRKRSGWEIK 82

  Fly    76 GDFIQPLDVRRSFSTSHKMPSSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPF 140
            |.       :.|.:|.:::.:..::|   .|.||                             |.
  Fly    83 GS-------KLSLNTHNRIRNIVESL---KIKPN-----------------------------PE 108

  Fly   141 DQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTD 205
            ..:|..:|||       |.||..           |.:.|  |.:|    |:|:..:......|..
  Fly   109 KPMIPLSIGD-------PTTFGN-----------LKAAD--ETMK----AVLHSLESGKYNGYAS 149

  Fly   206 SAGLEVVRRQVAQYI--EKRDGGIASNWQDIYLTGGASPGIK-SILSMINAEVGCKAPGVMVPIP 267
            :.|.|:.|:.||:|.  ::.||.|.:|  ::.|..|.|..:: .||::.:     :...|:||.|
  Fly   150 TQGHEIARKAVAKYSAHQRPDGEIDAN--EVVLCSGCSSALEYCILALAD-----RGQNVLVPRP 207

  Fly   268 QYPLYSATISEYGMTKVDYY-LEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLT 331
            .:.|| .|:::....:|.|| |..:..|..|..:|:...||     |..||::.||.||.|.|..
  Fly   208 GFCLY-YTLAQGLDIEVRYYDLLPDQQWRADLVQLESLIDE-----NTAALLINNPSNPCGSVFD 266

  Fly   332 RENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYL 396
            .:::.|:|.....:.:.::|||:|:..|: ..||..:...:..|       :.::|....:|.:|
  Fly   267 EKHLRELIAICERHYLPIIADEIYEHFVF-PGSKHLAVSSLTTE-------VPVLSCGGLTKRFL 323

  Fly   397 GECGIRGGYMEVLNLDPKVKAMLT--KSITA-ALCSTTAGQVAV-SALVNPPQPGEPSYDLYKKE 457
            .. |.|.|::.|.:...:::..:.  |::.. .|.|.|..|.|: ..|...||    ||      
  Fly   324 VP-GWRMGWIIVHDRKNRLRDAIVGLKNMCGRILGSNTIIQGALPDILTKTPQ----SY------ 377

  Fly   458 RDGILAALKERAELVHKALNSFEGYKVNPV--QGAMYV--------FPQIEIPPKAIEAAKAKGM 512
            .||::..|...|.|.:|.|....|  ::||  .||||:        ||:.:              
  Fly   378 FDGVIDVLHSNAMLAYKMLKQVRG--LDPVMPNGAMYMMIGVSIERFPEFK-------------- 426

  Fly   513 APDVFYAFELLETSGICIVPGSGFGQKPG 541
             .|..:..|::....:..:|||.| :.||
  Fly   427 -DDTHFVQEMVNEQSVFCLPGSCF-EYPG 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 111/461 (24%)
AAT_like 178..564 CDD:99734 98/382 (26%)
CG1461NP_001285238.1 tyr_amTase_E 79..481 CDD:273529 114/488 (23%)
AAT_like 112..475 CDD:99734 106/416 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467879
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.