DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and Accs

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001254463.1 Gene:Accs / 311218 RGDID:1309314 Length:475 Species:Rattus norvegicus


Alignment Length:349 Identity:82/349 - (23%)
Similarity:141/349 - (40%) Gaps:100/349 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 GDC-----------HAMGQQPLTFLRQLLALTFETRLL----DS----------PDYPEDVKKRA 188
            |:|           :.:|....||......|:...|::    ||          .:|.||  |..
  Rat    11 GECLRKPDQKQPKLYGVGDPTATFSSDSFCLSSRGRVIKWFWDSAEEGYRTYHMDEYDED--KNP 73

  Fly   189 CAILNGCQGQ----------------------SVGSYTDSAGLEVVRRQVAQYIE---------K 222
            ..|:|....:                      |:..|.|..|...:|::||:::.         |
  Rat    74 SGIINLGTSENKLCFDLLSWRLTQNDMLHVEPSLLQYPDWRGHRFLRKEVARFLSFYCKSPAPLK 138

  Fly   223 RDGGIASNWQDIYLTGGASPGIKSILSMINAEVGCKAPG--VMVPIPQYPLYSATISEYGMTKVD 285
            .:..:..|            |..|:.|.: |.|.|: ||  :::|.|.|...:..|..||..::.
  Rat   139 PENVVVLN------------GCASLFSAL-ATVLCE-PGEVLLIPTPYYGAITQHIYLYGNIRLA 189

  Fly   286 Y-YLEEE-TG-------WSLDRKE--LQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEII 339
            | ||:.: ||       .::::.|  ||....|..||   :.|::|||.||.|.:.:.|.:::.:
  Rat   190 YVYLDSKVTGLNTRPFQLTVEKLEMALQGVNSEGVKV---KGLILINPQNPLGDIYSPEELQDFL 251

  Fly   340 KFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGG 404
            .||..:|:.|:.||||..:|::::..:.|...:. .:.||.|...|   .:|||.: |..|:|.|
  Rat   252 GFAMRHKLHVIMDEVYMLSVFEESLGYRSVLSLE-RLPDPQRTHVM---WATSKDF-GMSGLRFG 311

  Fly   405 YMEVLNLDPKVKAMLTKSITAALC 428
            .:...|       ....:..|:||
  Rat   312 VLYTEN-------QHVATAVASLC 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 82/349 (23%)
AAT_like 178..564 CDD:99734 73/295 (25%)
AccsNP_001254463.1 PLN02450 35..475 CDD:178069 77/325 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352184
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.