DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and Kyat3

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:NP_001280489.1 Gene:Kyat3 / 229905 MGIID:2677849 Length:455 Species:Mus musculus


Alignment Length:421 Identity:85/421 - (20%)
Similarity:160/421 - (38%) Gaps:69/421 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAG-LEVVRRQVAQYIEKRDGGIASNWQDIYLTG 238
            :..|.|.::...:|..|.|      :..||...| ..:|:.....|.:.....|..| ::|.:..
Mouse    76 ISPPSYVKEELSKAAFIDN------MNQYTRGFGHPALVKALSCLYGKIYQRQIDPN-EEILVAV 133

  Fly   239 GASPGIKSILSMINAEVGCKAPG--VMVPIPQYPLYSATISEYGMTKVDYYLEEE---------T 292
            ||..      |:.|:..|...||  |::.:|.|..|...:...|...|...|..:         :
Mouse   134 GAYG------SLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPLRSKPTDGMKWTSS 192

  Fly   293 GWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQD 357
            .|:.|.:||:..:....|     |:::..|.||.|:|.||:.::.|......:..|.::||||:.
Mouse   193 DWTFDPRELESKFSSKTK-----AIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEW 252

  Fly   358 NVYDKNSKFWSFKKVAYEMGDPYRNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPK--VKAMLT 420
            .||..::..    |:|...|...|.:.:        |..|:.....|:....::.|.  :|.:.|
Mouse   253 LVYTGHTHV----KIATLPGMWERTITI--------GSAGKTFSVTGWKLGWSIGPAHLIKHLQT 305

  Fly   421 KSITAALCSTTAGQVAVSAL--VNPPQPGEPS--YDLYKKERDGILAALKERAELVHKALNSFEG 481
            ....:.....|..|.|::..  ::..:..:|.  ::...||       |:.:.:.:.:.|||. |
Mouse   306 VQQNSFYTCATPLQAALAEAFWIDIKRMDDPECYFNSLPKE-------LEVKRDRMVRLLNSV-G 362

  Fly   482 YKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFE----LLETSGICIVPGSGFGQKPGT 542
            .|.....|..::...:     :...|....|..|..|.::    :.:...:..:|.|.|......
Mouse   363 LKPIVPDGGYFIIADV-----SSLGADLSDMNSDEPYDYKFVKWMTKHKKLTAIPVSAFCDSKSK 422

  Fly   543 WHF----RSTILPQTDKLKLMMEKFRVFHAE 569
            .||    |...:.:...|....|.||.::::
Mouse   423 PHFEKLVRFCFIKKDSTLDAAEEIFRAWNSQ 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 85/421 (20%)
AAT_like 178..564 CDD:99734 83/411 (20%)
Kyat3NP_001280489.1 PRK07777 45..450 CDD:236095 85/416 (20%)
AAT_like 67..449 CDD:99734 84/415 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0436
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.