DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1640 and LOC100537633

DIOPT Version :9

Sequence 1:NP_727696.2 Gene:CG1640 / 32292 FlyBaseID:FBgn0030478 Length:575 Species:Drosophila melanogaster
Sequence 2:XP_021324394.1 Gene:LOC100537633 / 100537633 -ID:- Length:269 Species:Danio rerio


Alignment Length:261 Identity:93/261 - (35%)
Similarity:154/261 - (59%) Gaps:9/261 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 QVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDS 206
            :|:..:.||.|:.|.||:||:||::......|:|.....|.|.:.||..:|....|.|.||||:|
Zfish    14 KVLDVSSGDSHSAGIQPITFVRQVITGCLYPRILQGDTLPPDARLRAQTLLQHLDGGSTGSYTES 78

  Fly   207 AGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEVGCKAPG---VMVPIPQ 268
            .|...||..:|:.|..||||:.|:...:::|......:..:|.::     |::.|   ||:|.|.
Zfish    79 CGSMYVRNTIARSISLRDGGVLSHPDRVFITADTQRALMVMLRLL-----CQSEGVSAVMIPDPA 138

  Fly   269 YPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRE 333
            ....:..:...|:..|.:.|:|.:|||:||.||.|:...::..|:|||:.:.|||||||.|.:||
Zfish   139 PHTLTRLLDHVGIASVSFRLQETSGWSIDRAELNRAIQASRGRCSPRAIYISNPGNPTGAVQSRE 203

  Fly   334 NIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPY-RNLEMVSFLSTSKGYLG 397
            :||::|:||||.::.:|.:|.||:.|:....:|.|:|:|..||.:.: :::::.|..|.|.|.:|
Zfish   204 SIEDVIRFAHDERLFLLVNEEYQNTVFADGCEFVSYKRVLAEMDEEFSQSVQLASLHSLSNGIMG 268

  Fly   398 E 398
            |
Zfish   269 E 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1640NP_727696.2 PTZ00377 99..575 CDD:240391 93/261 (36%)
AAT_like 178..564 CDD:99734 80/225 (36%)
LOC100537633XP_021324394.1 Aminotran_1_2 21..>269 CDD:332562 90/252 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D365656at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.