DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and DMRTA1

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_071443.2 Gene:DMRTA1 / 63951 HGNCID:13826 Length:504 Species:Homo sapiens


Alignment Length:196 Identity:67/196 - (34%)
Similarity:93/196 - (47%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATA-S 181
            |||||||||||||:|.:|||||.||||:|.|..|.|:.:|||||||||||||||..|..||.. .
Human    93 RTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLQ 157

  Fly   182 STKSTGVTTASANNSSSSEGE-DSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQKR 245
            ....:|::......:|...|. ::..||..|.|.:                       ||     
Human   158 RLLCSGLSWPPGGRASGGGGRAENPQSTGGPAAGA-----------------------AL----- 194

  Fly   246 IYKQRLRSLQQSTLHITAAMEEYKQRFPTFSSPLMERMRKRRAFADPELNHVMEATLGGNALYFA 310
                .|.:|:|::...|.|.|.::|.:|.      |:..::.:..:...|...|.....:.||..
Human   195 ----GLGALRQASGSATPAFEVFQQDYPE------EKQEQKESKCESCQNGQEELISKSHQLYLG 249

  Fly   311 T 311
            :
Human   250 S 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 33/45 (73%)
DMRTA1NP_071443.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
DM 93..139 CDD:279137 33/45 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 170..192 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 266..307
CUE_DMA_DMRTA1 325..364 CDD:270600
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.