Sequence 1: | NP_511146.2 | Gene: | dmrt11E / 32291 | FlyBaseID: | FBgn0030477 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_071443.2 | Gene: | DMRTA1 / 63951 | HGNCID: | 13826 | Length: | 504 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 67/196 - (34%) |
---|---|---|---|
Similarity: | 93/196 - (47%) | Gaps: | 40/196 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATA-S 181
Fly 182 STKSTGVTTASANNSSSSEGE-DSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQKR 245
Fly 246 IYKQRLRSLQQSTLHITAAMEEYKQRFPTFSSPLMERMRKRRAFADPELNHVMEATLGGNALYFA 310
Fly 311 T 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt11E | NP_511146.2 | DM | 118..164 | CDD:279137 | 33/45 (73%) |
DMRTA1 | NP_071443.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..27 | ||
DM | 93..139 | CDD:279137 | 33/45 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 170..192 | 6/21 (29%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 266..307 | ||||
CUE_DMA_DMRTA1 | 325..364 | CDD:270600 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |