DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrtc1b

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001297543.1 Gene:Dmrtc1b / 632708 MGIID:3639121 Length:267 Species:Mus musculus


Alignment Length:234 Identity:49/234 - (20%)
Similarity:69/234 - (29%) Gaps:73/234 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MHFDETRSPNKDVRIGKSQRLAANGRQGTDPESDPLHARCVVPHASTPRGRRIPWGHNDDDDDGN 65
            ||..|||.| |..|.|.|        |||...|.| ....|:|:|                    
Mouse    93 MHKHETRPP-KTPREGSS--------QGTLMRSKP-QEPSVLPYA-------------------- 127

  Fly    66 HLTLPDSLTATSSCGCQCLNVRAPFHILLVDQQARMSKDASVRICQR--ERRLLRTPKCARCRNH 128
                |.:....|.......|: .|.        ||..:.:||.:...  ...||..|:......|
Mouse   128 ----PVTQQQQSVISYSAKNL-GPI--------ARPKRYSSVIVKNHAVTDPLLLQPQVPNATKH 179

  Fly   129 GVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATASSTKSTGVTTASA 193
            ..::.                    .|:.||.:.|..||...:........::|.|..|..|.|.
Mouse   180 DSVAA--------------------AVEWQRKLEAAEALLALRNSPLPPPVSASPKRHGKMTNSY 224

  Fly   194 NNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSS 232
            .....::|........||..:..|.|        :||:|
Mouse   225 LPGHGTQGSAGKRGQQPPSRYVPPRS--------ANSAS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 5/45 (11%)
Dmrtc1bNP_001297543.1 DMRT-like 140..265 CDD:292419 29/153 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.