DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrtb1

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_036020151.1 Gene:Dmrtb1 / 56296 MGIID:1927125 Length:397 Species:Mus musculus


Alignment Length:356 Identity:79/356 - (22%)
Similarity:105/356 - (29%) Gaps:146/356 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTME------ 174
            :||.|||:||||||.:..||||...|||::|.|..|.|:.:||::||||..||.|...|      
Mouse     1 MLRAPKCSRCRNHGYLVPVKGHTGKCRWKQCICDKCYLITERQKIMAAQKVLRTQAAEEQVATVG 65

  Fly   175 -----------ALEATASSTK-----------------------------STGVTTASANNSS-- 197
                       |..|||.|:.                             |.|.:|.....|.  
Mouse    66 TQGPQLPPRAPAAAATALSSSICPLPRAVPGGVGPGPTATCFLERPPQAPSPGPSTFQLGPSGRP 130

  Fly   198 ------------------SSEGEDSLSSTSPPPAHSHPHSH------------------------ 220
                              ||.....|...:|.|...:|..|                        
Mouse   131 GPSTFQPGPGAPGGLRDRSSAWLPQLMPQAPRPELCYPDQHLPVRPVPVPGPVRPVPRLPFADYG 195

  Fly   221 -------SHPTSCVSNSSSSSATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYKQRF------ 272
                   :.|.:|...::|.|.......|...........|:..:.|:..|....::.|      
Mouse   196 KPSLVQPTVPPACTRPAASGSKLESQTGAGVGKAPSPGHPLRFKSDHVVGAGNPEREPFKQCPAC 260

  Fly   273 ----PTFSSPLMERMRKRRAFADPE---LNHVMEATLGGNALYFATVAAAAAACAPVHQE----- 325
                |..|.||.|......|...|:   ..||                    :|:|.|:.     
Mouse   261 VPVSPYQSFPLSEGQDSSSALGVPQQRGFRHV--------------------SCSPYHRSGLVSE 305

  Fly   326 -----QHIY------HPMPPTIPLTIPPTNP 345
                 |..|      .|.||..||..||..|
Mouse   306 PARDLQPTYCSPPPPPPPPPPPPLPAPPPQP 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 25/45 (56%)
Dmrtb1XP_036020151.1 DM 3..49 CDD:395608 25/45 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.