DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmrt2b

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001073445.1 Gene:dmrt2b / 558970 ZFINID:ZDB-GENE-080813-1 Length:364 Species:Danio rerio


Alignment Length:252 Identity:86/252 - (34%)
Similarity:104/252 - (41%) Gaps:86/252 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEA 178
            |||.|:|||||||||||:|.:||||||||||:|.|.||.|||:|||||||||||||||..|..:.
Zfish    42 RRLSRSPKCARCRNHGVVSRLKGHKRLCRWRDCQCANCLLVVERQRVMAAQVALRRQQATEGKKG 106

  Fly   179 TASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQ 243
            ..:|.............:.|...:..|....||.....|                          
Zfish   107 QKNSAVLRRTAYQRYTRAPSLLAKSILEGYKPPVPEDWP-------------------------- 145

  Fly   244 KRIYKQRLRSLQQSTLHITAAMEEYKQRFPTFSSPLMERMRKRRAFADPELNHVM--------EA 300
            ||:::                            .|:..||||||||||.||..||        |.
Zfish   146 KRLHQ----------------------------PPVSVRMRKRRAFADKELETVMLERELRQREI 182

  Fly   301 TLGGNALYFATVAAAAAACAPVHQEQHIYHPMPPTIPLTIP--PT-------NPAMT 348
            ....:.|..|.|.:|               |.|...||:.|  ||       :|.:|
Zfish   183 EELPSLLLQAVVPSA---------------PSPYFFPLSDPIMPTFVPVSKNSPPLT 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 36/45 (80%)
dmrt2bNP_001073445.1 DM 46..92 CDD:279137 36/45 (80%)
Syntaphilin 105..>189 CDD:291936 24/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583837
Domainoid 1 1.000 95 1.000 Domainoid score I7354
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 1 1.000 - - FOG0007982
OrthoInspector 1 1.000 - - otm25635
orthoMCL 1 0.900 - - OOG6_142495
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5931
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.610

Return to query results.
Submit another query.