DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrt1

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_030106845.1 Gene:Dmrt1 / 50796 MGIID:1354733 Length:475 Species:Mus musculus


Alignment Length:124 Identity:55/124 - (44%)
Similarity:62/124 - (50%) Gaps:29/124 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTME-------- 174
            |.||||||||||..|.:|||||.|.||:|.|..|.|:.:|||||||||||||||..|        
Mouse    70 RLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQEEELGISHP 134

  Fly   175 -----ALEATASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVS 228
                 |.|.......:.......|.||||::         ||||       |.||...|
Mouse   135 IPLPSAAELLVKRENNASNPCLMAENSSSAQ---------PPPA-------STPTPAAS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 30/45 (67%)
Dmrt1XP_030106845.1 DM 70..116 CDD:366283 30/45 (67%)
Dmrt1 128..200 CDD:372081 15/66 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.