DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrtc2

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_008765121.1 Gene:Dmrtc2 / 499100 RGDID:1583739 Length:397 Species:Rattus norvegicus


Alignment Length:131 Identity:49/131 - (37%)
Similarity:72/131 - (54%) Gaps:23/131 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 QARMSKDASVRICQRERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMA 162
            :||:.:  |..:..| |.:.|:|.|||||||||.:.:|||||||.::.|.|..|.|:::|:||||
  Rat    48 EARVPQ--STELIPR-RPVSRSPTCARCRNHGVTAHLKGHKRLCLFQACECHKCVLILERRRVMA 109

  Fly   163 AQVALRRQQTMEALEATASSTKSTGVTTASAN------------NSSSSEGEDSLSSTSPPPAHS 215
            |||||||||     ||......:.|:...:|.            ......|::::   :|.|.:.
  Rat   110 AQVALRRQQ-----EAQLKRHLAQGLMKGAAPLKAPLRVKKGGIRPGVPSGKENI---APQPQNP 166

  Fly   216 H 216
            |
  Rat   167 H 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 27/45 (60%)
Dmrtc2XP_008765121.1 DM 65..111 CDD:279137 27/45 (60%)
DMRT-like 270..395 CDD:292419
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.