DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmrt3a

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001005779.2 Gene:dmrt3a / 450035 ZFINID:ZDB-GENE-021220-3 Length:448 Species:Danio rerio


Alignment Length:237 Identity:75/237 - (31%)
Similarity:105/237 - (44%) Gaps:68/237 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 ICQRERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTM 173
            :.|....|.|||||||||||||:|.:|||||.||:::|.|..|.|:::|||||||||||||||..
Zfish    15 VSQPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQAN 79

  Fly   174 EALEA--TASSTKSTGVTTASANNSSS-------------------------------SEGEDSL 205
            |:||:  ..|.....|:|.:|...|::                               |.||:. 
Zfish    80 ESLESLIPESLRALPGITVSSGEQSANPRASDIDLRWNTETGTPKTPQDLSDELSGEQSGGENG- 143

  Fly   206 SSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQKRIYKQRLRSLQQSTLHITAAME--EY 268
            .|...|.|.|.| ..|.|..|.:..:|..:.:                |::|...::.:..  |.
Zfish   144 GSDREPEAVSSP-EESKPNLCCTPDTSDPSPQ----------------LEESRFGLSKSCSDPEP 191

  Fly   269 KQRFPTFSSPLMERMRKRRAFADPELNHVMEATLGGNALYFA 310
            |...|.:|               ||.|.::|...|..:|.|:
Zfish   192 KSDNPKYS---------------PEPNLLIEGLSGSVSLPFS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 31/45 (69%)
dmrt3aNP_001005779.2 DM 24..70 CDD:279137 31/45 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..203 22/137 (16%)
CUE_DMA_DMRTA3 221..263 CDD:270602
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 424..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.