Sequence 1: | NP_511146.2 | Gene: | dmrt11E / 32291 | FlyBaseID: | FBgn0030477 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001005779.2 | Gene: | dmrt3a / 450035 | ZFINID: | ZDB-GENE-021220-3 | Length: | 448 | Species: | Danio rerio |
Alignment Length: | 237 | Identity: | 75/237 - (31%) |
---|---|---|---|
Similarity: | 105/237 - (44%) | Gaps: | 68/237 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 ICQRERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTM 173
Fly 174 EALEA--TASSTKSTGVTTASANNSSS-------------------------------SEGEDSL 205
Fly 206 SSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQKRIYKQRLRSLQQSTLHITAAME--EY 268
Fly 269 KQRFPTFSSPLMERMRKRRAFADPELNHVMEATLGGNALYFA 310 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt11E | NP_511146.2 | DM | 118..164 | CDD:279137 | 31/45 (69%) |
dmrt3a | NP_001005779.2 | DM | 24..70 | CDD:279137 | 31/45 (69%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 98..203 | 22/137 (16%) | |||
CUE_DMA_DMRTA3 | 221..263 | CDD:270602 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 424..448 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3815 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D383821at33208 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.820 |