DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmrt93B

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_524428.1 Gene:dmrt93B / 42494 FlyBaseID:FBgn0038851 Length:325 Species:Drosophila melanogaster


Alignment Length:298 Identity:82/298 - (27%)
Similarity:123/298 - (41%) Gaps:87/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTME---ALEAT 179
            |.||||||||||:||.::|||:||.::.|.|..|.|:.:|||:|||||||:|||.:|   |:...
  Fly    39 RVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQRIMAAQVALKRQQAVEDAIAMRLV 103

  Fly   180 ASSTKST----------GVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSS 234
            |:.|..:          |:|....::..:...:|.:..|.......|.....      ...|.|.
  Fly   104 ANKTGRSIDALPPGNIFGLTVTQPSSPRAKREDDQVEKTISEVEQQHLKQRE------EEYSESP 162

  Fly   235 ATRQALMAQKR-------------IYKQRLRS-----LQQSTLHITAAMEEYKQRFPTFSSPLME 281
            |..|.|.|.:|             ::.||.||     |::..|.:..|:|...   ||..|..::
  Fly   163 AVAQDLSAPRRDNVSQTAIDMLAQLFPQRKRSVLELVLKRCDLDLIRAIENVS---PTGKSSPVD 224

  Fly   282 RMRKRRAFADP-------------------------ELNHVME---ATLGGNALYFATVAAAAAA 318
            ....:....:|                         :...|:|   ...||:    |:.|||||.
  Fly   225 VTSNQLPSQEPGMLTTMPQPAPPRSSAFRPVITDQYQSKSVVELKPPVFGGS----ASAAAAAAI 285

  Fly   319 CAPVHQEQHIYHP---MPPTIPLTIPPTN---PAMTTP 350
            ||         :|   :|.:.|:|:...:   |..|.|
  Fly   286 CA---------YPKWFVPLSFPVTMGHLSNLAPRCTLP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 27/45 (60%)
dmrt93BNP_524428.1 DM 39..85 CDD:279137 27/45 (60%)
CUE_DMA 176..214 CDD:270553 8/37 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.