powered by:
Protein Alignment dmrt11E and Dmrta2
DIOPT Version :9
Sequence 1: | NP_511146.2 |
Gene: | dmrt11E / 32291 |
FlyBaseID: | FBgn0030477 |
Length: | 377 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001101421.2 |
Gene: | Dmrta2 / 313471 |
RGDID: | 1308173 |
Length: | 536 |
Species: | Rattus norvegicus |
Alignment Length: | 85 |
Identity: | 50/85 - (58%) |
Similarity: | 58/85 - (68%) |
Gaps: | 13/85 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEA---- 178
|||||||||||||:|.:|||||.|||::|.|..|.|:.:|||||||||||||||..|..||
Rat 65 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQ 129
Fly 179 ----TASSTKSTGVTTASAN 194
||. |:..|:||
Rat 130 LLYGTAE-----GLALAAAN 144
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
dmrt11E | NP_511146.2 |
DM |
118..164 |
CDD:279137 |
32/45 (71%) |
Dmrta2 | NP_001101421.2 |
DM |
65..111 |
CDD:395608 |
32/45 (71%) |
CUE_DMA_DMRTA2 |
311..352 |
CDD:270601 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.