DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmrt2a

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_571027.1 Gene:dmrt2a / 30129 ZFINID:ZDB-GENE-990621-7 Length:507 Species:Danio rerio


Alignment Length:274 Identity:90/274 - (32%)
Similarity:120/274 - (43%) Gaps:92/274 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 ERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALE 177
            :|:|.|||||||||||||:||:|||||.||||:|.|.||.|||:|||||||||||||||..|   
Zfish    52 QRKLSRTPKCARCRNHGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQATE--- 113

  Fly   178 ATASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMA 242
                  ...|:|                                              .:|..:.
Zfish   114 ------DKKGIT----------------------------------------------GKQIPVE 126

  Fly   243 QKRIYKQRLRSLQQSTLHITAAMEEYKQ--------RFPTFSSPLMERMRKRRAFADPELNHVM- 298
            ::.||::.:|   .||:...:.:|.|:.        ..|....||.:||||||||||.||..:| 
Zfish   127 RRNIYQRHIR---PSTMLAKSILEGYRPVQNDPFLGANPALPPPLSDRMRKRRAFADKELETIML 188

  Fly   299 ----------EATLGGNALYFATVAAAAAACAPVHQEQHIYHP--MPPTIPLTIPPTN------- 344
                      |:|...:|..|...:...||      |.:.|..  ...:.|.|:.|:.       
Zfish   189 EREYKERELLESTQSNSASLFMPGSMVHAA------EYNSYKTAFSSASAPSTVEPSPKDLCGFL 247

  Fly   345 PAMTTPAVTTASTG 358
            |.....::..|:||
Zfish   248 PGCLDLSLQYAATG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 37/45 (82%)
dmrt2aNP_571027.1 DM 57..103 CDD:279137 37/45 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583836
Domainoid 1 1.000 95 1.000 Domainoid score I7354
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 1 1.000 - - FOG0007982
OrthoInspector 1 1.000 - - otm25635
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10870
SonicParanoid 1 1.000 - - X5931
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.740

Return to query results.
Submit another query.