DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrt3

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001099828.1 Gene:Dmrt3 / 293976 RGDID:1306043 Length:476 Species:Rattus norvegicus


Alignment Length:253 Identity:81/253 - (32%)
Similarity:120/253 - (47%) Gaps:38/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATA 180
            |.|||||||||||||:|.:|||||.||:::|.|..|.|:::|||||||||||||||..|:||:..
  Rat    23 LQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQANESLESLI 87

  Fly   181 SST----------KSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVS-NSSSSS 234
            ..:          .....|.|:|:.||.:      |..|.|||...|.:.....:.:. .:....
  Rat    88 PDSLRALPGPPPPGDAAATAATASQSSPA------SQASQPPAPPRPATELAAAAALRWVAEPQP 146

  Fly   235 ATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYK-----QRFPTFSSPLMERMRKRRAFADPEL 294
            .|..|.:|:..:.:.||.....:    ..|.|.:.     ||    |||  :.::.:..|. ||.
  Rat   147 GTLPAQIAKPDLTEDRLGDSSSA----DNAAESFSDKDTDQR----SSP--DVVKSKNCFT-PES 200

  Fly   295 NHVMEATLGGNALYFATVAAAAAACAP-VHQEQ-HIYHPMPP---TIPLTIPPTNPAM 347
            ..::....||.|:........:...:| .|.|| |:....|.   ::|.::....|.:
  Rat   201 PEIVSVDEGGYAVQKNGGNPESCPDSPKYHAEQSHLLIEGPSGTVSLPFSLKANRPPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 31/45 (69%)
Dmrt3NP_001099828.1 DM 25..71 CDD:395608 31/45 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..130 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..195 12/57 (21%)
CUE_DMA_DMRTA3 253..295 CDD:270602 1/6 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.