powered by:
Protein Alignment dmrt11E and Dmrta2
DIOPT Version :9
Sequence 1: | NP_511146.2 |
Gene: | dmrt11E / 32291 |
FlyBaseID: | FBgn0030477 |
Length: | 377 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_758500.2 |
Gene: | Dmrta2 / 242620 |
MGIID: | 2653629 |
Length: | 531 |
Species: | Mus musculus |
Alignment Length: | 85 |
Identity: | 50/85 - (58%) |
Similarity: | 58/85 - (68%) |
Gaps: | 13/85 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEA---- 178
|||||||||||||:|.:|||||.|||::|.|..|.|:.:|||||||||||||||..|..||
Mouse 65 RTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEARELQ 129
Fly 179 ----TASSTKSTGVTTASAN 194
||. |:..|:||
Mouse 130 LLYGTAE-----GLALAAAN 144
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3815 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.