DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrta1

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_783578.1 Gene:Dmrta1 / 242523 MGIID:2653627 Length:490 Species:Mus musculus


Alignment Length:178 Identity:66/178 - (37%)
Similarity:86/178 - (48%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 RTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATASS 182
            |||||||||||||:|.:|||||.||||:|.|..|.|:.:|||||||||||||||..|..||....
Mouse    82 RTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEESEARGLH 146

  Fly   183 ----TKSTGVTTASANNSSSSEGEDSLSSTSP-----PPAHSHPHSHSHPTSCV----------- 227
                ..|:|....::..|..:|....|::...     ..|..||.|.|.||..|           
Mouse   147 RLLYQGSSGSGAQASGGSGRTESPQVLNNPMAVAVLGAGASRHPGSRSVPTFEVFQQDYADRKQE 211

  Fly   228 --SNSSSSSATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYKQRFP 273
              ..:..|..:||    ::.:......||..|..::|...:.:....|
Mouse   212 PKQRNCESCQSRQ----EEPVSNTHHHSLGSSKGNVTVEKQGFMSSIP 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 33/45 (73%)
Dmrta1NP_783578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
DM 82..128 CDD:279137 33/45 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..171 4/18 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 207..289 8/53 (15%)
DMA 315..350 CDD:281472
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.