DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrt3

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_796334.2 Gene:Dmrt3 / 240590 MGIID:2449470 Length:476 Species:Mus musculus


Alignment Length:250 Identity:81/250 - (32%)
Similarity:123/250 - (49%) Gaps:32/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 LLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATA 180
            |.|||||||||||||:|.:|||||.||:::|.|..|.|:::|||||||||||||||..|:||:..
Mouse    23 LQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQRVMAAQVALRRQQANESLESLI 87

  Fly   181 SST----------KSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVS-NSSSSS 234
            ..:          .....|.|:|:.||.:      |..|.|||...|.:.....:.:. .:....
Mouse    88 PDSLRALPGPPPPGDAAATAATASQSSPA------SQASQPPAPPRPTAELAAAAALRWVAEPQP 146

  Fly   235 ATRQALMAQKRIYKQRLRSLQQSTLHITAAM--EEYKQRFPTFSSPLMERMRKRRAFADPELNHV 297
            .|..|.:|:..:.::|:.. ..||.:...|.  ::..||    |||  :.::.:..|. ||...:
Mouse   147 GTLPAQLAKPDLTEERVGD-SSSTDNTAEAFSDKDTDQR----SSP--DVVKSKNCFT-PESPEI 203

  Fly   298 MEATLGGNALYFATVAAAAAACAP-VHQEQ-HIYHPMPP---TIPLTIPPTNPAM 347
            :....||.|:........:...:| .|.|| |:....|.   ::|.::....|.:
Mouse   204 VSVDEGGYAVQKNGGNPESCPDSPKYHAEQSHLLIEGPSGTVSLPFSLKANRPPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 31/45 (69%)
Dmrt3NP_796334.2 DM 25..71 CDD:366283 31/45 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..130 11/46 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 147..195 12/54 (22%)
CUE_DMA_DMRTA3 253..295 CDD:270602 1/5 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 418..476
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.