DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and Dmrt2

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_665830.1 Gene:Dmrt2 / 226049 MGIID:1330307 Length:561 Species:Mus musculus


Alignment Length:303 Identity:96/303 - (31%)
Similarity:125/303 - (41%) Gaps:102/303 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QGTDPESDPLHARCVVPHASTPRGRRIPW---GHNDDDD-----------DGNHLTL-------- 69
            :..|.|.|    .|..|..:||.....|.   |..|:|:           ||....:        
Mouse    18 ESLDLEED----SCGTPLRATPPQEPSPAAADGEEDEDEEEEDEDVEDEGDGEEPGVSSEVPGRP 78

  Fly    70 --PDSLTATSSCGCQCLNVRAPFHILLVDQQARMSKDASVRICQRERRLLRTPKCARCRNHGVIS 132
              |..|........|.|...|          |...:.|:.......|:|.|||||||||||||:|
Mouse    79 EQPGGLAPRPPPAAQALPAAA----------AAPERGATAGGGAEPRKLSRTPKCARCRNHGVVS 133

  Fly   133 CVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATASSTKSTGVTTASANNSS 197
            |:|||||.||||:|.|.||.|||:|||||||||||||||                          
Mouse   134 CLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQ-------------------------- 172

  Fly   198 SSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQKRIYKQRLRS---LQQSTL 259
            ::|.:..||.                             :|....:|.:|::::|:   |.:|.|
Mouse   173 ATEDKKGLSG-----------------------------KQNNFDRKAVYQRQVRAPSLLAKSIL 208

  Fly   260 H----ITAAMEEYKQRFPTFSSPLMERMRKRRAFADPELNHVM 298
            .    :||  |.|.........|:.:||||||||||.||.::|
Mouse   209 EGYRPMTA--ETYLGGTLPLPPPVSDRMRKRRAFADKELENIM 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 37/45 (82%)
Dmrt2NP_665830.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 22/114 (19%)
DM 119..165 CDD:279137 37/45 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839753
Domainoid 1 1.000 95 1.000 Domainoid score I7407
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 1 1.000 - - FOG0007982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10870
SonicParanoid 1 1.000 - - X5931
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.740

Return to query results.
Submit another query.