DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmd-8

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_503176.2 Gene:dmd-8 / 188771 WormBaseID:WBGene00020708 Length:369 Species:Caenorhabditis elegans


Alignment Length:393 Identity:85/393 - (21%)
Similarity:135/393 - (34%) Gaps:136/393 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ETRSPNKDVR--IGKSQRLAANGRQGTDPESDPLHARCVVPHASTPRGRRIPWGHNDDDDDGNHL 67
            |..|||..:.  :| :||..:.|::  .|:....|......|......|    ||..:       
 Worm    19 EGLSPNNSLSPDVG-AQRFFSQGKR--IPKDVKRHCGMCKQHGVFVETR----GHTCE------- 69

  Fly    68 TLPDSLTATSSCGC-QCLNVRAPFHILLVDQQARMSKDASVRICQR------------------- 112
                    ..||.| ||..||....|:....:.|..:|...   ||                   
 Worm    70 --------YRSCECEQCDLVRKRREIMSTQIRLRREQDKKF---QRTNDISEANVFPGFTGGEAD 123

  Fly   113 ERRLLRTPK----CARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQ--- 170
            |:.::....    |.:|:||.|:...|.||:.|::..|.|..|.| :|.:|.:...:..|:.   
 Worm   124 EKAVMENMNMCYFCQKCKNHNVLVWKKNHKKECQYSSCECQQCNL-IDSRRALDRHIKKRKMSIK 187

  Fly   171 -QTMEALEATASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSS 234
             .|:||:  ...|.|..|.||||:::.|||.|                        |.|:.|:||
 Worm   188 GNTVEAI--APKSPKKEGSTTASSSSLSSSSG------------------------CNSDESASS 226

  Fly   235 ATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYKQRFPTFSSPLMERMRKRRAFADPELNHVME 299
            :.                                    .:.|..|.|::...     |::....:
 Worm   227 SD------------------------------------CSLSGMLSEKLNMA-----PQVQMKFD 250

  Fly   300 ATLGGNALYFATVAAAAAACAPVHQEQHIYHPMP---PTIPLTIPPTNPA------MTTPAV--T 353
            .:.||..:..||  :|.|:.:|.........|||   |..|:.:|...|:      :|.|::  |
 Worm   251 FSAGGFMIPAAT--SANASTSPAGSPFETTSPMPLLLPHSPIALPQLAPSSLPLSFLTVPSLMST 313

  Fly   354 TAS 356
            .||
 Worm   314 AAS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 15/49 (31%)
dmd-8NP_503176.2 DM 47..98 CDD:214606 14/69 (20%)
DM 133..186 CDD:214606 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.