DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and F21F3.4

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001362009.1 Gene:F21F3.4 / 184785 WormBaseID:WBGene00017674 Length:393 Species:Caenorhabditis elegans


Alignment Length:124 Identity:28/124 - (22%)
Similarity:42/124 - (33%) Gaps:39/124 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VMAAQVALRRQQTMEALEATASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPT 224
            |:...|.....|..:|::|...      |.:.||.|||..:.|:.::..|....|   ..|..|.
 Worm   298 VICGSVLAPEDQDCQAVKAYLD------VMSMSAINSSKLKKEEKVTRKSSGGGH---EEHQKPY 353

  Fly   225 SCVSNSSSSSATRQALMAQKRIY-------KQRLRSLQQSTLHITAAMEEYKQRFPTFS 276
            ..                 ::||       |:.:.|..||.|.|.      |:..|.||
 Worm   354 EI-----------------RKIYPKIPVGVKRSISSSSQSGLPIV------KKARPGFS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 1/3 (33%)
F21F3.4NP_001362009.1 DUF4708 12..267 CDD:374137
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.