DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmd-10

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001379162.1 Gene:dmd-10 / 183202 WormBaseID:WBGene00007929 Length:348 Species:Caenorhabditis elegans


Alignment Length:197 Identity:61/197 - (30%)
Similarity:91/197 - (46%) Gaps:27/197 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RCVVPHASTPRGRRIPWGHNDDDDDGNH-LTLPDSLTATSSCGC----QCLNVRAPFHILLVDQQ 98
            ||:  :...||.|:            || ...|.:......||.    :.||:|...:.....:.
 Worm    45 RCL--NHDVPRPRK------------NHKCECPYADCTCEKCGLVEKRRILNIRLQNYNQFNIEN 95

  Fly    99 ARMSKDASVRICQRERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAA 163
            ...||...|....::::..|.|.|.:|..||..|.:|||||.|.:|||.|..|.:|.:||::||.
 Worm    96 ENDSKLIIVEDDDKKKQGERVPNCQKCGQHGRKSRLKGHKRSCPFRECPCAKCAVVSERQKLMAD 160

  Fly   164 QVALRRQQTMEALEATASSTKSTGVTTASANNSSSSEGEDSL----SSTSPPPAHSHPHSHSHPT 224
            |:.:||:|..:.|...|   |::..:|...:|..|....:||    .:|||.|..|.|.| |..:
 Worm   161 QIKIRRRQRKDTLLTFA---KNSITSTMFPSNQISLNALNSLLYGSINTSPQPLLSSPTS-SDAS 221

  Fly   225 SC 226
            ||
 Worm   222 SC 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 23/45 (51%)
dmd-10NP_001379162.1 DM 39..92 CDD:214606 13/60 (22%)
DM 115..168 CDD:214606 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164775
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.