DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and dmd-4

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_510466.1 Gene:dmd-4 / 181581 WormBaseID:WBGene00007776 Length:260 Species:Caenorhabditis elegans


Alignment Length:293 Identity:83/293 - (28%)
Similarity:118/293 - (40%) Gaps:88/293 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 QRERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEA 175
            :|||:    ||||||||||::|.:|||||.|:::||.|..|.|:.:|||||||||||:|:|..| 
 Worm    15 ERERK----PKCARCRNHGLVSWLKGHKRHCKYKECACEKCNLIAERQRVMAAQVALKRRQATE- 74

  Fly   176 LEATASSTKSTGVTTASAN---------NSSSSEGED------SLSSTSPPPAHSHPHSHSHPTS 225
             :|.|...:   |....|.         |::..|.||      .:....|.|.            
 Worm    75 -DAIALGLR---VVAGQAIDRLPQGPVWNTAGGEDEDMDYLDEEIEEKPPTPV------------ 123

  Fly   226 CVSNSSSSSATRQALMAQKRIYKQRLRSLQQSTLHITAAMEEYKQRFPTFSSPLMERMRKRRAFA 290
                                  .:.|..|::..:..|..:..:        ||:...|   ..|.
 Worm   124 ----------------------SEELVPLKRKKVEETYELSSF--------SPIELLM---TLFC 155

  Fly   291 DPELNHVMEATL---GGNAL----YFATVAAA---------AAACAPVHQEQHIYHPMPPTIPLT 339
            :.| .||:|..|   .||.|    :||.|...         |||....|...::.:.:.|.....
 Worm   156 EHE-KHVLELVLEACHGNVLQAIEHFANVRRVKNINQMKLFAAATRMDHVFPNMTNFILPKQSFL 219

  Fly   340 IPPTNPAMTTPAVTTASTGSGKKPKLSFSIESI 372
            |.......|.|..:.|||.:  |...|.|::||
 Worm   220 IDSLLEQPTFPVSSQASTST--KTCDSSSVDSI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 28/45 (62%)
dmd-4NP_510466.1 DM 18..64 CDD:366283 29/49 (59%)
CUE_DMA 142..181 CDD:270553 12/50 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.