Sequence 1: | NP_511146.2 | Gene: | dmrt11E / 32291 | FlyBaseID: | FBgn0030477 | Length: | 377 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001022464.1 | Gene: | mab-3 / 174533 | WormBaseID: | WBGene00003100 | Length: | 290 | Species: | Caenorhabditis elegans |
Alignment Length: | 212 | Identity: | 61/212 - (28%) |
---|---|---|---|
Similarity: | 91/212 - (42%) | Gaps: | 58/212 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 79 CGC-QCLNVRAPFHILLVDQQARMSKDASVRICQ-------RERRLLRTPKCARCRNHGVISCVK 135
Fly 136 GHKR-LCRWRECCCPNCQLVVDRQRVMAAQVALRRQQ--------------------TMEALEAT 179
Fly 180 ASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQK 244
Fly 245 RIY-----KQRLRSLQQ 256 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dmrt11E | NP_511146.2 | DM | 118..164 | CDD:279137 | 22/46 (48%) |
mab-3 | NP_001022464.1 | DM | 24..77 | CDD:214606 | 6/33 (18%) |
DM | 90..144 | CDD:214606 | 27/53 (51%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR12322 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |