DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and mab-3

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001022464.1 Gene:mab-3 / 174533 WormBaseID:WBGene00003100 Length:290 Species:Caenorhabditis elegans


Alignment Length:212 Identity:61/212 - (28%)
Similarity:91/212 - (42%) Gaps:58/212 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 CGC-QCLNVRAPFHILLVDQQARMSKDASVRICQ-------RERRLLRTPKCARCRNHGVISCVK 135
            |.| :|         .:|:|:.:::...|.:...       |:.:.:|.|.||||..|||:..::
 Worm    52 CPCREC---------TMVEQRRQLNNLLSKKKIHCTPATQTRDGKRVRDPHCARCSAHGVLVPLR 107

  Fly   136 GHKR-LCRWRECCCPNCQLVVDRQRVMAAQVALRRQQ--------------------TMEALEAT 179
            |||| :|::..|.|..|.||..|:.:||||:.|||.|                    .||.:..|
 Worm   108 GHKRTMCQFVTCECTLCTLVEHRRNLMAAQIKLRRSQQKSRDGKEPKRNSRRKSKDMDMEMMVVT 172

  Fly   180 ASSTKSTGVTTASANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQK 244
            |:..:....|:||.:.||:::......|.|||              | |.|...:.....|.|..
 Worm   173 ATDGQKIIGTSASPSPSSTTDTMSPSLSMSPP--------------C-SPSPLLAQYTLTLAAPI 222

  Fly   245 RIY-----KQRLRSLQQ 256
            .||     .|:|.||||
 Worm   223 PIYPPIPMNQQLISLQQ 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 22/46 (48%)
mab-3NP_001022464.1 DM 24..77 CDD:214606 6/33 (18%)
DM 90..144 CDD:214606 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12322
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.