DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and DMRT2

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:NP_001374487.1 Gene:DMRT2 / 10655 HGNCID:2935 Length:561 Species:Homo sapiens


Alignment Length:399 Identity:119/399 - (29%)
Similarity:159/399 - (39%) Gaps:131/399 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 AANGRQGTDPESDPLHAR-CVVPHASTPRGRRIPWG----HNDDDDDG---NHLTLPDSLTATSS 78
            :|.|....|.||..|... |..|. |||.|...|..    .:|:||||   :.....|...|.:|
Human     8 SAAGDWEIDVESLELEEDVCGAPR-STPPGPSPPPADGDCEDDEDDDGVDEDAEEEGDGEEAGAS 71

  Fly    79 CGC----------QCLNVRAPFHILLVDQQARMSKDASVRIC------QRERRLLRTPKCARCRN 127
            .|.          |.....||        ||..:.......|      ...|:|.||||||||||
Human    72 PGMPGQPEQRGGPQPRPPLAP--------QASPAGTGPRERCTPAGGGAEPRKLSRTPKCARCRN 128

  Fly   128 HGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQTMEALEATASSTKSTGVTTAS 192
            |||:||:|||||.||||:|.|.||.|||:|||||||||||||||                     
Human   129 HGVVSCLKGHKRFCRWRDCQCANCLLVVERQRVMAAQVALRRQQ--------------------- 172

  Fly   193 ANNSSSSEGEDSLSSTSPPPAHSHPHSHSHPTSCVSNSSSSSATRQALMAQKRIYKQRLRSLQQS 257
                 ::|.:..||.                             :|....:|.:|::::|:   .
Human   173 -----ATEDKKGLSG-----------------------------KQNNFERKAVYQRQVRA---P 200

  Fly   258 TLHITAAMEEYKQ---------RFPTFSSPLMERMRKRRAFADPELNHVM------EATLGGNAL 307
            :|...:.:|.|:.         .|| ...|:.:||||||||||.||.::|      |..:     
Human   201 SLLAKSILEGYRPIPAETYVGGTFP-LPPPVSDRMRKRRAFADKELENIMLEREYKEREM----- 259

  Fly   308 YFATVAAAAAACAP--------VHQEQHIYHPMPPTIPLTIPPT----NPAMTTPAVTTASTGSG 360
              ...:.|||...|        .:..:..|.|.|     ..||:    |...|...:|...:|||
Human   260 --LETSQAAALFLPNRMVPGPDYNSYKSAYSPSP-----VEPPSKDFCNFLPTCLDLTMQYSGSG 317

  Fly   361 KKPKLSFSI 369
            ....:|.::
Human   318 NMELISSNV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 37/45 (82%)
DMRT2NP_001374487.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119 30/119 (25%)
DM 119..165 CDD:395608 37/45 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 414..435
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149701
Domainoid 1 1.000 95 1.000 Domainoid score I7438
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D383821at33208
OrthoFinder 1 1.000 - - FOG0007982
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R10870
SonicParanoid 1 1.000 - - X5931
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.