DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dmrt11E and LOC100359752

DIOPT Version :9

Sequence 1:NP_511146.2 Gene:dmrt11E / 32291 FlyBaseID:FBgn0030477 Length:377 Species:Drosophila melanogaster
Sequence 2:XP_038953287.1 Gene:LOC100359752 / 100359752 RGDID:2323488 Length:735 Species:Rattus norvegicus


Alignment Length:235 Identity:50/235 - (21%)
Similarity:86/235 - (36%) Gaps:81/235 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RSPNKDVRIGKSQRLAANGRQ---------GTD--------PESD---PLHARCVVP---HASTP 48
            :.||.::|:     ||.|..|         ||:        |.||   .:|.|...|   .|.|.
  Rat   532 KRPNSNIRV-----LAGNLSQKGSKPLQEKGTEFYDRKKEQPLSDLRQTVHLREARPSCTRAVTQ 591

  Fly    49 RGRRIPWG--HNDDDDDGNHLTLPDSLTA---TSSCG--CQCLNVRAPFHILLVDQQARMSKDAS 106
            ..|....|  :|.|...|.    .|:||:   |...|  .:.|.:::..||...|.:   ::|:.
  Rat   592 TSRNSVAGVKNNVDIHPGG----KDNLTSRFITQILGKSHESLKLKSQPHIFESDLE---TEDSQ 649

  Fly   107 VRICQRERRLLRTPKCARCRNHGVISCVKGHKRLCRWRECCCPNCQLVVDRQRVMAAQVALRRQQ 171
            :    ::::|....:.|....|..|.                              ::.|..|:|
  Rat   650 L----QQQQLANQVQEADAAEHSPIE------------------------------SRAARSRRQ 680

  Fly   172 TMEALEATASSTKSTGVTTASANNSSSSEGEDSLSSTSPP 211
            |: .||::.:|||    ..:||.:......:..:|:|:.|
  Rat   681 TV-CLESSRASTK----RCSSAAHQRQYSSKTQVSNTAKP 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dmrt11ENP_511146.2 DM 118..164 CDD:279137 3/45 (7%)
LOC100359752XP_038953287.1 DUF4708 50..323 CDD:406292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3815
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.