DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Syt12 and DOC2B

DIOPT Version :10

Sequence 1:NP_572878.1 Gene:Syt12 / 32290 FlyBaseID:FBgn0261085 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_003576.2 Gene:DOC2B / 8447 HGNCID:2986 Length:412 Species:Homo sapiens


Alignment Length:86 Identity:23/86 - (26%)
Similarity:35/86 - (40%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 LSPPTVSCFTSGFEAYVFPTKYST-PNTWHVDN----YKKIMSNESYVDENSTCHGDMCFIAKV- 263
            |.||.|.  ..|.......::.|| .||..:|:    ||.|.||.:.|...:|..|.:..:|.: 
Human   105 LVPPLVG--LKGNLEMTLASRLSTSANTGQIDDRQERYKIISSNLAVVQVQATVVGLLAAVASLM 167

  Fly   264 --AADAGEYDFDVYYKGCIST 282
              .....|:|:......|.|:
Human   168 LGTVSHEEFDWSKVALLCTSS 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Syt12NP_572878.1 C2 503..602 CDD:425499
C2B_Synaptotagmin-12 612..753 CDD:176051
DOC2BNP_003576.2 Mediates interaction with DYNLT1. /evidence=ECO:0000269|PubMed:9804756 1..90
Negatively regulates targeting to plasma membrane. /evidence=ECO:0000250 1..36
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..123 5/19 (26%)
C2A_Rabphilin_Doc2 127..250 CDD:176000 16/62 (26%)
Mediates interaction with STXBP3. /evidence=ECO:0000250 257..375
C2B_Rabphilin_Doc2 269..401 CDD:176030
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.