DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K2 and Ip6k3

DIOPT Version :9

Sequence 1:NP_572873.2 Gene:IP3K2 / 32285 FlyBaseID:FBgn0283680 Length:691 Species:Drosophila melanogaster
Sequence 2:XP_008771000.1 Gene:Ip6k3 / 688862 RGDID:1584104 Length:401 Species:Rattus norvegicus


Alignment Length:316 Identity:70/316 - (22%)
Similarity:110/316 - (34%) Gaps:112/316 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 QTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDG 438
            |..:|...|| .|..||.:          |.:||                       .|...:..
  Rat   160 QIERKGFNPW-GLHCHQAH----------LSRLC-----------------------SQYPEDKR 190

  Fly   439 ELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAA 503
            ..:|.|::::|.|.|||::|.|:|.|.:.::    |.|:.|.|                   |..
  Rat   191 HRFLLLENVVSQYKQPCILDLKMGTRQHGDD----ASEEKKAR-------------------HMK 232

  Fly   504 KAVTKPRYMVWRETISSTATLGFRIEGI------KKSDGTSSKDFKTTKSREQIKLAFLEFLSGH 562
            |...           |::|.||.||.|:      |||.....|.:....|.|..:.|..:||...
  Rat   233 KCAQ-----------STSACLGVRICGMQVYQTDKKSFLCKDKYYGRKLSVEGFRQALSQFLHDG 286

  Fly   563 PHILPRYIQR-LRAIRATLAVSEFFQTHEVIGSSLLFVHD----------QT------------- 603
            ..:....::. ||.::|.|.|.....::....||||.::|          ||             
  Rat   287 IRLRTELLEPILRRLQALLTVIRSQSSYRFYSSSLLIIYDGEPPQTAPAPQTTQGSTSGSTSGDP 351

  Fly   604 -HASIWLIDFAKTVELPPQLRIDHYSAWK----VGNHEDGYLIGINNLIDIFVELQ 654
             ...:.:||||.|.         :..:|.    ....:.||:.|:.|||.|..::|
  Rat   352 AKVDVRMIDFAHTT---------YKGSWNERTTYEGPDPGYIFGLENLIGILRDIQ 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K2NP_572873.2 IPK 441..650 CDD:281727 57/243 (23%)
Ip6k3XP_008771000.1 IPK 193..395 CDD:281727 58/244 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.