DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K2 and CG10082

DIOPT Version :9

Sequence 1:NP_572873.2 Gene:IP3K2 / 32285 FlyBaseID:FBgn0283680 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_726095.2 Gene:CG10082 / 37465 FlyBaseID:FBgn0034644 Length:902 Species:Drosophila melanogaster


Alignment Length:387 Identity:71/387 - (18%)
Similarity:128/387 - (33%) Gaps:154/387 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 TVLKKLCPKEEECFQILMHDLLRPYVPVYKG--QVTSEDG------------------------- 438
            ||:|.|..:|.:.:|.:..|:|: :||.|||  |.|:..|                         
  Fly   203 TVIKPLNLRELDFYQNIPQDILK-FVPKYKGVMQATTMGGAKLDKRYSPSFRDDAAAVPVRKMSA 266

  Fly   439 ----------------------------------ELYLQLQDLLSDYVQPCVMDCKVGVRTYLEE 469
                                              :.:|.|:::.|.:..||::|.|:|.|.:.: 
  Fly   267 SKRKRDEVLRMKVHKNGQAAEVIKSISQLDNTNKQYFLMLENITSQFRNPCILDLKMGTRQHGD- 330

  Fly   470 ELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIKKS 534
                                  |:.|....:..||...           |::.:||.|:.|::  
  Fly   331 ----------------------DASAEKRSKQMAKCAA-----------STSGSLGVRLCGMQ-- 360

  Fly   535 DGTSSKDFKTTKSREQ----------IKLAFLEFL-SGHP---HILPRYIQRLRAIRATLAVSEF 585
              |...|.:....|::          .|.|..:|. :|:.   .::.:.:|||..:|   .|.|.
  Fly   361 --TYLADLEQYAKRDKYWGRELNEGGFKTALHDFFHNGYRLRIRVIRKILQRLLQLR---RVIEK 420

  Fly   586 FQTHEVIGSSLLFVHDQTHASIWLIDFAKTVELPPQLRIDHY-----SAWKVGN----HEDGYLI 641
            ..::.....|||.|::....:        .:..||.:..|.:     ||...|.    |.:    
  Fly   421 QSSYRFYSCSLLIVYEGFEEN--------PMAPPPSMSQDEWPEAPRSATVPGTVFDYHPE---- 473

  Fly   642 GINNLIDIFVE------LQASMEAEAH--------AQAQAEAIQSPVSGSGGDQAEQTGEES 689
              |::.:..:|      .:|..|.|||        ..|.:....:..|.:|||......:.|
  Fly   474 --NSIDEDDLEDDDEAGNEAGDELEAHDTDDDLHLVAADSGNASATNSSTGGDACNYDADAS 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K2NP_572873.2 IPK 441..650 CDD:281727 43/231 (19%)
CG10082NP_726095.2 IPK 303..>450 CDD:281727 37/195 (19%)
IPK <821..894 CDD:299948
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455385
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12400
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.