DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K2 and Ipk2

DIOPT Version :9

Sequence 1:NP_572873.2 Gene:IP3K2 / 32285 FlyBaseID:FBgn0283680 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_608535.1 Gene:Ipk2 / 33236 FlyBaseID:FBgn0031267 Length:309 Species:Drosophila melanogaster


Alignment Length:324 Identity:77/324 - (23%)
Similarity:128/324 - (39%) Gaps:98/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 QLAGH---QGNFKA-----GPEPGTVLKKL----CPKEEECFQILMHD-----------LLRPYV 426
            |:|||   :.|.:|     ..:.|.|||.|    |.:.|..|...:.:           |||.:|
  Fly    18 QVAGHTFEESNAEAVGLLQDSKAGCVLKPLGKPECGERELRFYESLAEAGASGDNDLLALLRGHV 82

  Fly   427 PVYKGQ---VTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKM 488
            |.:.|.   |.:.....:|:|:||...|.:|||||.|:|.||: :.|.|..|.|.:..|.:..|.
  Fly    83 PRFYGPLKLVVNRRERTFLRLEDLTRSYAKPCVMDVKMGKRTW-DPESSPNKRKVEEAKYVMCKQ 146

  Fly   489 --------IQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGIKKSDGTSSKDFKTT 545
                    .|:  :.| .|||..:.........:.::::        :||.|:   |.:..|..:
  Fly   147 KLGLCLPGFQV--YLP-KEEHTQETTILRHGKDYGKSLN--------VEGFKQ---TMALFFNAS 197

  Fly   546 KSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHEVI---GSSLLFVHD------ 601
            .|..:.:.|..|.|      |...:::|:.|.|      :||...::   .||||..:|      
  Fly   198 TSDSKSRRAGCELL------LKEVLRQLQEILA------WFQRQRLLHFYASSLLICYDYSRLAD 250

  Fly   602 ----------------QTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDI 649
                            .|...:.:||||            |....:.|..::.|:.|:.:||::
  Fly   251 PPKPLINGYHQNDDDPATWVRVKMIDFA------------HVYPAEQGLPDENYMFGLQSLIEV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K2NP_572873.2 IPK 441..650 CDD:281727 56/242 (23%)
Ipk2NP_608535.1 IPK 100..304 CDD:281727 56/242 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455383
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12400
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.