DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K2 and itpkcb

DIOPT Version :9

Sequence 1:NP_572873.2 Gene:IP3K2 / 32285 FlyBaseID:FBgn0283680 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001292400.1 Gene:itpkcb / 322720 ZFINID:ZDB-GENE-080225-27 Length:634 Species:Danio rerio


Alignment Length:454 Identity:197/454 - (43%)
Similarity:264/454 - (58%) Gaps:67/454 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SPGCGKDDGQSDVSAASSCSNLY---------YCG-------STISALDGG-----------ECI 271
            ||..|:..|:.:..|.|.|..:.         .||       |.::...||           .|.
Zfish   186 SPVSGRQSGEVEQQATSPCPRIIPKLIVTHDDLCGGQDCPRISDLTLSTGGFSLDLHPDEDSPCS 250

  Fly   272 VNGVRVALA-----RK-SSTQSSSLSDEEEEEEDDDEDRDEQDRDEDDRDAEEMLQEDYERGDRE 330
            .:|...:.|     || ||:.|:.||.....||.:|                     |:...|.|
Zfish   251 DSGCGGSPAPSLFHRKLSSSSSAGLSSASSFEESED---------------------DFTGSDIE 294

  Fly   331 RERERQISELMAATQLGDRQRDRSKKSSGWRKIRNIVQWTPFFQTYKKQRYPWVQLAGHQGNFKA 395
               ...:|..|.|:.      |....:..|||::::|..:||..::|| ||||||||||.|:|:|
Zfish   295 ---PTSLSPSMFASP------DELTGAKSWRKLKSMVHCSPFVVSFKK-RYPWVQLAGHAGSFQA 349

  Fly   396 GPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVYKGQVTSEDGELYLQLQDLLSDYVQPCVMDCK 460
            | |.|.:|||.|..|::|.:.||:|.|||:||.|.| |..::.:.|..:.|||.|:..|.:||||
Zfish   350 G-ENGKLLKKYCECEQQCLEKLMNDDLRPFVPGYYG-VVQQNEQDYNIMDDLLKDFDSPSIMDCK 412

  Fly   461 VGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSHAPTAEEHAAKAVTKPRYMVWRETISSTATLG 525
            :|.||||||||.||:|:|:||||||:||:.:|..||:.||.:.:||.|||||.||||:|||||||
Zfish   413 MGSRTYLEEELVKARERPRLRKDMYEKMVAVDPTAPSPEERSQQAVLKPRYMQWRETLSSTATLG 477

  Fly   526 FRIEGIKKSDGTSSKDFKTTKSREQIKLAFLEFLSGHPHILPRYIQRLRAIRATLAVSEFFQTHE 590
            ||||||||:|||.:..||.||..||:..||.:|:.|:.::|..|:.||..:|..|..|.||:|||
Zfish   478 FRIEGIKKADGTCNTSFKKTKHEEQVMKAFGDFVDGNTNLLRNYLLRLEELRCALENSHFFRTHE 542

  Fly   591 VIGSSLLFVHDQTH-ASIWLIDFAKTVELPPQLRIDHYSAWKVGNHEDGYLIGINNLIDIFVEL 653
            |:|||||||||.:. |.:|:|||.|||.|||...:||.:.|..||.|||||.|::|||.||..:
Zfish   543 VVGSSLLFVHDASGLARVWMIDFGKTVPLPPPQILDHRTPWAEGNREDGYLWGLDNLIHIFTNM 606

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K2NP_572873.2 IPK 441..650 CDD:281727 122/209 (58%)
itpkcbNP_001292400.1 IPK 393..604 CDD:281727 123/210 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 275 1.000 Domainoid score I1715
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 328 1.000 Inparanoid score I2443
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D410791at33208
OrthoFinder 1 1.000 - - FOG0001484
OrthoInspector 1 1.000 - - otm24950
orthoMCL 1 0.900 - - OOG6_103318
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1215
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.