DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IP3K2 and IP6K3

DIOPT Version :9

Sequence 1:NP_572873.2 Gene:IP3K2 / 32285 FlyBaseID:FBgn0283680 Length:691 Species:Drosophila melanogaster
Sequence 2:NP_001136355.1 Gene:IP6K3 / 117283 HGNCID:17269 Length:410 Species:Homo sapiens


Alignment Length:329 Identity:73/329 - (22%)
Similarity:112/329 - (34%) Gaps:116/329 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 NIVQWTPFFQTYKKQRYPWVQLAGHQGNFKAGPEPGTVLKKLCPKEEECFQILMHDLLRPYVPVY 429
            ::|:.|...|..:|...|| .|..||.:          |.:||.:..|                 
Human   156 SLVEDTNGNQVERKSFNPW-GLQCHQAH----------LTRLCSEYPE----------------- 192

  Fly   430 KGQVTSEDGELYLQLQDLLSDYVQPCVMDCKVGVRTYLEEELSKAKEKPKLRKDMYDKMIQIDSH 494
                  .....:|.|::::|.|..|||:|.|:|.|.:.::    |.|:.|.|             
Human   193 ------NKRHRFLLLENVVSQYTHPCVLDLKMGTRQHGDD----ASEEKKAR------------- 234

  Fly   495 APTAEEHAAKAVTKPRYMVWRETISSTATLGFRIEGI------KKSDGTSSKDFKTTKSREQIKL 553
                  |..|...           |::|.||.||.|:      ||......|.:....|.|..:.
Human   235 ------HMRKCAQ-----------STSACLGVRICGMQVYQTDKKYFLCKDKYYGRKLSVEGFRQ 282

  Fly   554 AFLEFLSGHPHILPRYIQR-LRAIRATLAVSEFFQTHEVIGSSLLFVHD---------------- 601
            |..:||....|:....::. |..:||.|:|.....::....||||.::|                
Human   283 ALYQFLHNGSHLRRELLEPILHQLRALLSVIRSQSSYRFYSSSLLVIYDGQEPPERAPGSPHPHE 347

  Fly   602 ------------QTHASIWLIDFAKTVELPPQLRIDHYSAWKVGNHED----GYLIGINNLIDIF 650
                        .|...|.:||||.|.         :...|......|    ||:.|:.|||.|.
Human   348 APQAAHGSSPGGLTKVDIRMIDFAHTT---------YKGYWNEHTTYDGPDPGYIFGLENLIRIL 403

  Fly   651 VELQ 654
            .::|
Human   404 QDIQ 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
IP3K2NP_572873.2 IPK 441..650 CDD:281727 58/247 (23%)
IP6K3NP_001136355.1 IPK 198..404 CDD:309046 59/248 (24%)
Substrate binding. /evidence=ECO:0000250 211..219 5/7 (71%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..358 0/24 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.