DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and Gatm

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_112293.1 Gene:Gatm / 81660 RGDID:71090 Length:423 Species:Rattus norvegicus


Alignment Length:321 Identity:66/321 - (20%)
Similarity:117/321 - (36%) Gaps:92/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 ENG-----KFDVQLAKQQHEQYCTLLRTIGLDVIELPPDD-----QLPE----GVFVENSAVICN 69
            :||     |..::.|..:.|:.|.:|...|:.|....|.|     :.|:    |::   ||:..:
  Rat   109 KNGGLYFPKDHLKKAVAEVEEMCNILSMEGVTVKRPDPIDWSLKYKTPDFESTGLY---SAMPRD 170

  Fly    70 GVALIGRS--EHP----KRQLEAESMAIILKK---------------------ELDIPVIEIEDP 107
            .:.::|..  |.|    .|..|..:...|:|.                     :.|.|:..:||.
  Rat   171 ILMVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKWTTAPKPTMADELYDQDYPIHSVEDR 235

  Fly   108 N---AQ-----------LDGGDVLFTGREFFVGISSFTNEEG----ARAVAMAYPEYPV------ 148
            :   ||           .|..|.:..||:.|...|..||..|    .|.:|   |:|.|      
  Rat   236 HKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLA---PDYRVHIISFK 297

  Fly   149 --TPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEI-VKRMEREAICTYQKLTLPEES------- 203
              .|:.::.|      ..:.||.::..:....|.:| :.:.....|.|.....:|::.       
  Rat   298 DPNPMHIDAT------FNIIGPGLVLSNPDRPCHQIDLFKKAGWTIVTPPTPVIPDDHPLWMSSK 356

  Fly   204 --AANMLYINGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGLTS-SCLLLRR 261
              :.|:|.::...|.....|:|  .:.:.||:.|.|..:||...:....|... :|.:.||
  Rat   357 WLSMNVLMLDEKRVMVDANEVP--IQKMFEKLGISTIKVNIRNANSLGGGFHCWTCDVRRR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 39/186 (21%)
GatmNP_112293.1 Amidinotransf 86..409 CDD:302778 63/313 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1834
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.