DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and ddah2

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001004924.1 Gene:ddah2 / 448306 XenbaseID:XB-GENE-486753 Length:272 Species:Xenopus tropicalis


Alignment Length:269 Identity:100/269 - (37%)
Similarity:157/269 - (58%) Gaps:9/269 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPKYTHAIVARISDALLE--NGKFDVQLAKQQHEQYCTLLR-TIGLDVIELPPDDQLPEGVFVE 62
            ||.:||||:|..:..:|.:  ||:.|:..|::::..||.:|| .:||.|:||||:::||:|..:.
 Frog     1 MSGRYTHAVVRGVPSSLAKEANGQVDLARAQRENGVYCGILRQKLGLQVVELPPNEELPQGQLIG 65

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            ::||:....|||.|...|.|:.|.|.:..|. :||...|.|:.|.||.||..|:||||.|.|||:
 Frog    66 DTAVVIADTALITRPWIPARRKETEGLQKIF-EELKFRVCELNDENATLDASDILFTGSEIFVGL 129

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |.:||..||..||..|.:|.|:.:.|:|...||.:.:|.||:.|.:.||.|.::.:|.||:....
 Frog   130 SKWTNLRGAEMVAKTYQDYAVSTVPVSGDLHLKSFCSMGGPDTLVIGSSDTAKKALKTMEQLTDH 194

  Fly   193 TYQKLTLPEESAANMLYI-----NGTIVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSSGL 252
            .|:.||:|::.|||.:|.     :..::|||..|.|.:.:..::..|........:|.|:....|
 Frog   195 HYETLTVPDDPAANCIYARVGPKSNVLIHRSVDEYPNSAQVFQKLTDYTLVPATCTELSKIGGFL 259

  Fly   253 TSSCLLLRR 261
            ||..:|:.|
 Frog   260 TSCSILINR 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 54/125 (43%)
ddah2NP_001004924.1 Amidinotransf 3..263 CDD:418538 96/260 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469762at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12737
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5737
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.140

Return to query results.
Submit another query.