DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and ddah1

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_998441.1 Gene:ddah1 / 406561 ZFINID:ZDB-GENE-010724-13 Length:264 Species:Danio rerio


Alignment Length:265 Identity:98/265 - (36%)
Similarity:156/265 - (58%) Gaps:16/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AIVARISDALLEN---GKFDVQLAKQQHEQYCTLLR-TIGLDVIELPPDDQLPEGVFVENSAVIC 68
            |:.|.:|.|.|.:   ...|....:::.:.|.::|| .:||.|:.||.|::||:.||||::||:|
Zfish     3 AMPASLSTAALRSDNVSPVDPLGVQREFDHYVSVLRDRLGLQVVMLPADEELPDCVFVEDTAVVC 67

  Fly    69 NGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGISSFTNE 133
            ...|||.|...|.|:.|..:|...| .||.:.::|:.|.:|.:|||||||||:|||||:|..||:
Zfish    68 GSTALITRPGAPSRRSETVAMKGAL-TELGLNIVEMNDESATMDGGDVLFTGKEFFVGLSKRTNQ 131

  Fly   134 EGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAICTYQKLT 198
            .||..:|..:.:|.|:.|.|.....||.:.:||||.::.:.||...|:.:|.:::.:.|.|:|||
Zfish   132 RGAEILANTFKDYAVSTIPVEEGLHLKSFCSMAGPNLIAIGSSDAAQKALKVIQQMSDCKYEKLT 196

  Fly   199 LPEESAANMLYIN-----GTIVHRSPTEIPEA---YKTLKEKIDIPTRNINISEFSQYSSGLTSS 255
            :|::.|||.:|:|     ..::|.:|...||:   ::.||..:.||..|   .|..:....||..
Zfish   197 VPDDRAANCVYMNLPGKGDVLLHCTPEVFPESAKVFERLKSHMLIPVSN---QEKMKVDGALTCL 258

  Fly   256 CLLLR 260
            .:|||
Zfish   259 SVLLR 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 54/125 (43%)
ddah1NP_998441.1 Amidinotransf 20..264 CDD:302778 93/248 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583254
Domainoid 1 1.000 66 1.000 Domainoid score I10008
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8120
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1469762at2759
OrthoFinder 1 1.000 - - FOG0004837
OrthoInspector 1 1.000 - - otm24738
orthoMCL 1 0.900 - - OOG6_104993
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.750

Return to query results.
Submit another query.