DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and Ddah2

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_001159408.1 Gene:Ddah2 / 294239 RGDID:1302955 Length:285 Species:Rattus norvegicus


Alignment Length:269 Identity:91/269 - (33%)
Similarity:150/269 - (55%) Gaps:16/269 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 THAIVARISDALLEN-----GKFDVQLAKQQHEQYC---TLLRTIGLDVIELPPDDQLPEGVFVE 62
            :||::..:.::|...     |...:.|||.|.|...   .|.:.:||.::||||::.||.|..:.
  Rat    12 SHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLG 76

  Fly    63 NSAVICNGVALIGRSEHPKRQLEAESMAIILKKELDIPVIEIEDPNAQLDGGDVLFTGREFFVGI 127
            ::|||....|||.|...|.|:.|.:.:...| ::|.:.::|:.|.||.|||.||||||||||||:
  Rat    77 DTAVIQGDTALITRPWSPARRPEVDGVRKAL-QDLGLRIVEMGDENATLDGTDVLFTGREFFVGL 140

  Fly   128 SSFTNEEGARAVAMAYPEYPVTPIRVNGTKRLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREAIC 192
            |.:||..||..||..:.::.|:.:.|:|...|:....|.||..:...||...|:.|:.|......
  Rat   141 SKWTNHRGAEIVADTFRDFAVSTVPVSGASHLRGLCGMGGPRTVVAGSSEAAQKAVRAMAALTDH 205

  Fly   193 TYQKLTLPEESAANMLYIN----GT---IVHRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSS 250
            .|..||||:::|::.|::.    ||   ::||...::|.:.:.|::..|:....::.||..:..:
  Rat   206 PYASLTLPDDAASDCLFLRPGLPGTTPFLLHRGGGDLPNSQEALQKLSDVTLVPVSCSELEKVGA 270

  Fly   251 GLTSSCLLL 259
            ||:|.||:|
  Rat   271 GLSSLCLVL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 53/127 (42%)
Ddah2NP_001159408.1 Amidinotransf <62..277 CDD:418538 76/215 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1834
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 178 1.000 Inparanoid score I3920
OMA 1 1.010 - - QHG56587
OrthoDB 1 1.010 - - D1469762at2759
OrthoFinder 1 1.000 - - FOG0004837
OrthoInspector 1 1.000 - - otm44894
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12737
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4029
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.870

Return to query results.
Submit another query.