DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and gatm

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_955825.1 Gene:gatm / 266799 ZFINID:ZDB-GENE-021015-1 Length:422 Species:Danio rerio


Alignment Length:315 Identity:58/315 - (18%)
Similarity:118/315 - (37%) Gaps:80/315 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KFDVQLAKQQHEQYCTLLRTIGLDVIELPPDD-----QLPE----GVFVENSAVICNGVALIGRS 77
            |..||.|..:.|:.|.:|:..|:.|....|.|     :.|:    |::   :|:..:.:.::|..
Zfish   116 KEHVQKAVAEIEEMCNILQHEGVTVRRPEPVDWSLEYRTPDFSSTGMY---AAMPRDILMVVGNE 177

  Fly    78 --EHP----KRQLEAESMAIILKK---------------------ELDIPVIEIEDPN---AQ-- 110
              |.|    .|..|..:...::|:                     :.|.|:..:||.:   ||  
Zfish   178 IIEAPMAWRARFFEYRAYRPLIKEYFRRGARWTTAPKPTMADQLYDQDYPIRTVEDRHKLAAQGK 242

  Fly   111 ---------LDGGDVLFTGREFFVGISSFTNEEG----ARAVAMAYPEYPVT-----PIRVNGTK 157
                     .|..|.:..|.:.||..|..||..|    .|.::..|..:.::     |:.::.| 
Zfish   243 FVTTEFEPCFDAADFIRAGTDIFVQRSQVTNYMGIEWMRRHLSPTYKIHIISFKDPNPMHIDAT- 306

  Fly   158 RLKYYVTMAGPEVLCVSSSPTCQEIVKRMEREA---ICTYQKLTLPEE----SAANMLYINGTIV 215
                 ..:.||.::..:....|::|  .|.::|   :.|.....:|:.    .::..|.:|..::
Zfish   307 -----FNIIGPGLVLSNPDRPCRQI--EMFKKAGWTVVTPPTPLIPDNHPLWMSSKWLSMNVLML 364

  Fly   216 HRSPTEIPEAYKTLK---EKIDIPTRNINISEFSQYSSGLTSSCLLLRRWKSIRS 267
            ......:.....|::   |.:.|.|..::|...:....|.......:||..:::|
Zfish   365 DEKRVMVDANESTIQKMFESLGIKTVKVSIRHANSLGGGFHCWTTDVRRRGTLQS 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 36/178 (20%)
gatmNP_955825.1 Amidinotransf 85..408 CDD:302778 55/302 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1834
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.