DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1764 and F38H4.5

DIOPT Version :9

Sequence 1:NP_001285198.1 Gene:CG1764 / 32281 FlyBaseID:FBgn0030467 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_502245.1 Gene:F38H4.5 / 185480 WormBaseID:WBGene00009549 Length:284 Species:Caenorhabditis elegans


Alignment Length:270 Identity:53/270 - (19%)
Similarity:99/270 - (36%) Gaps:61/270 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DVQLAKQQHEQYCTLLRTIGLDVIELPPDD--QLPEGVFVENSAVICNGVALIGRSEHPKRQLEA 86
            |.:.|.:|.:...:.:...|.:|:.:..:|  ..|:.||..|:.::......:.....|:|..| 
 Worm    41 DFEKATKQWDTLKSTIEKCGAEVVVMESEDARDYPDIVFCANAGILRGNKIYLSHFAFPERYGE- 104

  Fly    87 ESMAIILKKELDIPVIEIEDPNAQL--DGGDVLFTGREFFVGISSFTNEEGARAVAMAYPEYPVT 149
               .:..|:..|....:....:..:  ..||.|:.|.    |::...:..|.|:...|..:.   
 Worm   105 ---HVFYKRFFDKLGYQTSFNHKIIHEGAGDALWCGN----GMNILVSGVGPRSDVQACQDI--- 159

  Fly   150 PIRVNGTKRLK------YYVTMAG----------------PEVLCVSSSPTCQEIVKRMEREAIC 192
                  .::||      :||..|.                .|.|.::..|....:    .:..|.
 Worm   160 ------KRKLKLNSDDTFYVVAARLVDPRFYHVDTCFCPLDEDLAMAYMPAFDSV----SQNNIR 214

  Fly   193 TY-QKLTLPEESA----ANMLYINGTIV--HRSPTEIPEAYKTLKEKIDIPTRNINISEFSQYSS 250
            .| ..|.:||:.|    .|.:.|...::  |.|.|    .:|.| |:.......|::|||.:  :
 Worm   215 NYTDLLPVPEKDARRFVCNSVVIGKNVIVHHGSDT----TFKLL-EQHGFQVHPIDMSEFMK--A 272

  Fly   251 GLTSSCLLLR 260
            |.::.|..||
 Worm   273 GGSAKCCTLR 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1764NP_001285198.1 Amidinotransf 24..>149 CDD:302778 23/128 (18%)
F38H4.5NP_502245.1 Amidinotransf 14..283 CDD:302778 53/270 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1834
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.