DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and SAL1

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_201203.3 Gene:SAL1 / 836519 AraportID:AT5G63980 Length:353 Species:Arabidopsis thaliana


Alignment Length:339 Identity:67/339 - (19%)
Similarity:106/339 - (31%) Gaps:128/339 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPR-- 121
            |.|.||.:||.... .:....:...|:...:.|:|:   .|.|.||..|..|:...|::....  
plant     5 KELDAAKKAASLAA-RLCQKVQKALLQSDVQSKSDK---SPVTVADYGSQAVVSLVLEKELSSEP 65

  Fly   122 VQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDV----------TVNAQDV-------------- 162
            ..:.:|||....::....|   |:...|..:.|.          |::..|:              
plant    66 FSLVAEEDSGDLRKDGSQD---TLERITKLVNDTLATEESFNGSTLSTDDLLRAIDCGTSEGGPN 127

  Fly   163 -TVWV-DPLDATKEFTE-ELYEYVTTMVCVAVA------GRPIIGVIHSPFN------------- 205
             ..|| ||:|.||.|.. :.|         |||      |:.::||:..| |             
plant   128 GRHWVLDPIDGTKGFLRGDQY---------AVALGLLEEGKVVLGVLACP-NLPLASIAGNNKNK 182

  Fly   206 ------GQTAWAWVGN---------------------------SMSEYLSNLHPQHSPNN----- 232
                  |...:|.:|:                           |..|.....|..|..::     
plant   183 SSSDEIGCLFFATIGSGTYMQLLDSKSSPVKVQVSSVENPEEASFFESFEGAHSLHDLSSSIANK 247

  Fly   233 ---QAPIITVSRSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSKIKKWDIC 294
               :||.:.:......||  |:|   |:....|.....||:.                 |.||..
plant   248 LGVKAPPVRIDSQAKYGA--LSR---GDGAIYLRFPHKGYRE-----------------KIWDHV 290

  Fly   295 AGDAILHALGGTMT 308
            ||..::...||.:|
plant   291 AGAIVVTEAGGIVT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 67/339 (20%)
SAL1NP_201203.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.