DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and IMPL2

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_195623.3 Gene:IMPL2 / 830067 AraportID:AT4G39120 Length:375 Species:Arabidopsis thaliana


Alignment Length:361 Identity:74/361 - (20%)
Similarity:131/361 - (36%) Gaps:89/361 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RINRLPATIVAILLT---FVLVYFLNFHQEERPAIYGMLRSENPSRVN---LRKMLIAAIQAAQR 70
            |::.|.::.:|:.::   |.|....|   .:||.|    .:|:||.::   |.:........|..
plant    68 RLSFLSSSAIAVPVSRRRFCLTMASN---SKRPNI----SNESPSELSDTELDRFAAVGNALADA 125

  Fly    71 GGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVQIFSEEDKEHCKQ 135
            .| ||:     |:...:.....|:....|.|.||..:...|...:.:..|...|:.||....||:
plant   126 SG-EVI-----RKYFRKKFDIVDKDDMSPVTIADQMAEEAMVSIIFQNLPSHAIYGEEKGWRCKE 184

  Fly   136 AHGYDLDPTVLHETAQIPDVTVNAQDVTVWV-DPLDATKEFTEELYEYVT------TMVCVAVAG 193
                        |:|..           ||| ||:|.||.|       :|      |::.:...|
plant   185 ------------ESADY-----------VWVLDPIDGTKSF-------ITGKPVFGTLIALLYKG 219

  Fly   194 RPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVSRSHTAGAKDLARGIFGEN 258
            :||:|:|..|...:   .|:|  |:...:.|:.:.......|.::.:..:|....     :|.|.
plant   220 KPILGLIDQPILKE---RWIG--MNGRRTKLNGEDISTRSCPKLSQAYLYTTSPH-----LFSEE 274

  Fly   259 VS----------LLTAAGAGYKVLQVVANNATAYLHTSKIKKWDICAGDAILHALGGTMTTLNDQ 313
            ..          .:...|.......::|:.....:..|.:|.:|..|...::...|||:|....:
plant   275 AEKAYSRVRDKVKVPLYGCDCYAYALLASGFVDLVIESGLKPYDFLALVPVIEGAGGTITDWTGK 339

  Fly   314 LINYGPEESPVNT-------------EGLLATLEQH 336
            ...:....|.|.|             :..|.:||.|
plant   340 RFLWEASSSAVATSFNVVAAGDSDIHQQALESLEWH 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 61/308 (20%)
IMPL2NP_195623.3 PLN02911 80..375 CDD:178499 70/347 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.