DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and AT4G05090

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_192418.1 Gene:AT4G05090 / 825853 AraportID:AT4G05090 Length:397 Species:Arabidopsis thaliana


Alignment Length:385 Identity:93/385 - (24%)
Similarity:142/385 - (36%) Gaps:107/385 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 YGMLRSENP---SRVNLRKMLIAAIQAAQRGGLEVLDVARSR-QLKERSKGKTDEGVNDPFTDAD 104
            |.::|:..|   .:....|.|..||.|..|.....:||.||. ..||:...|.|:   .|.|.||
plant    30 YFIVRANLPFPKHQAKYHKELEVAIDAVDRACRLCVDVKRSLFSSKEKIVEKNDQ---TPVTIAD 91

  Fly   105 GRSHCVMKQGLQRIFPRVQIFSEEDKEHCKQAHGYDLDPTVLHET---AQIPDVTVNAQDV---- 162
            .....::...|.::||.:.:.:||| .|..:|:  :|..:|:.|.   |.|.|..::..||    
plant    92 FGVQALVSLELSKLFPSIPLVAEED-SHFVRAN--NLVSSVVSEVKSKASIGDNHLSDADVLEAI 153

  Fly   163 ---------------TVWV-DPLDATKEF---TEELYEYVTTMVCVAVAGRPIIGVIHSPFNGQT 208
                           |.|| ||:|.|:.|   .|.||   ...:.:.|....::||:..|     
plant   154 DRGGKDAYTFCNKPATYWVLDPIDGTRGFLKGDEALY---VVGLALVVDNEIVLGVMGCP----- 210

  Fly   209 AWAWVGNSMSEYLSNLHPQH-------------SPN----------------NQAPIITVSRSHT 244
              .|.|:|.......|...|             |.|                |:|. ..:..|.|
plant   211 --NWPGDSSDGSTGTLMLSHIGCGTWTKKLQNVSGNVAGDWIRCFVDACVLMNKAR-FCIQESQT 272

  Fly   245 AGAKDLARGIFG-----------ENVSLLTAAGAGYKVLQVVANNATAYLHTSK----IKKWDIC 294
            ..:..|: |.|.           |.:.|.|..|:..|.|.|.:..|:.:|..:|    ||.||..
plant   273 WESLPLS-GFFDASTVSEDLKHKEILLLPTCCGSLCKYLMVASGRASVFLLRAKTQRTIKSWDHA 336

  Fly   295 AGDAILHALGGTMTTLNDQLINYGPEESP----------VNTEGLLATLEQHDEYMDKLS 344
            .|...:|..||.:|......||...::|.          |.:.|.|     |::.::.:|
plant   337 VGIICVHEAGGKVTDWEGDEINLEEDQSERRLIFPAGGVVVSNGSL-----HNQILEMIS 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 89/363 (25%)
AT4G05090NP_192418.1 PAP_phosphatase 49..391 CDD:238775 88/364 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.