DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and Bpnt1

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006250491.1 Gene:Bpnt1 / 64473 RGDID:621833 Length:323 Species:Rattus norvegicus


Alignment Length:332 Identity:94/332 - (28%)
Similarity:145/332 - (43%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LRKMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPR 121
            |.:::.:|...||:.|..|..|.....|....|    ....|..|.||......:...|.|.||:
  Rat     8 LMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQK----TSATDLQTKADRMVQMSICSSLSRKFPK 68

  Fly   122 VQIFSEEDKEHCKQAHGYDLDP----TVLHETAQIPDV----------TVNAQDVTVWVDPLDAT 172
            :.|..||           ||.|    ..|.|..|..::          .:..:|:.|||||:|.|
  Rat    69 LTIIGEE-----------DLPPGEVDQELIEDGQSEEILKQPCPSQYSAIKEEDLVVWVDPVDGT 122

  Fly   173 KEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN-------------------------GQTAWAW 212
            ||:||.|.:.||.::.:|..|:.|.|:|:.|:.                         |:|.|..
  Rat   123 KEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQNNEKEKLREHRNEAKAGPDAVLGRTIWGV 187

  Fly   213 VGNSMSEYLSNLHPQHSPNNQAP----IITVSRSHTAG-AKDLARGIFGENVSLLTAAGAGYKVL 272
            :|  :..:...|       .:||    |||.:|||:.. ..|....:..:||  |...|||.|::
  Rat   188 LG--LGAFGFQL-------KEAPAGKHIITTTRSHSNKLVTDCIAAMNPDNV--LRVGGAGNKII 241

  Fly   273 QVVANNATAYLHTSK-IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLATLEQH 336
            |::...|:||:..|. .||||.||.:.||||:||.:|.::...:.|..|...:|:.|:||.|..:
  Rat   242 QLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNPLQYDKEVKHMNSAGVLAALRNY 306

  Fly   337 DEYMDKL 343
            :.|..::
  Rat   307 EYYASRV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 93/327 (28%)
Bpnt1XP_006250491.1 IPPase 11..312 CDD:238818 93/326 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.