DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and CG17027

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001261909.1 Gene:CG17027 / 39742 FlyBaseID:FBgn0036553 Length:288 Species:Drosophila melanogaster


Alignment Length:267 Identity:58/267 - (21%)
Similarity:100/267 - (37%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 DPFTDADGRSHCVMKQGLQRIFPRVQIFSEEDKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDV 162
            |..||.|.:....:.:.:...:|..:...||                   |||:..:|:....:.
  Fly    46 DVVTDYDNKIEDFLMEKILARYPDHKFIGEE-------------------ETAKNNNVSGELTNA 91

  Fly   163 TVW-VDPLDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN--------GQTAWAWVGNSMS 218
            ..| :||:|.|..|.::: .:|...:.:|:..:.::|||::|..        ||.|:.       
  Fly    92 PTWIIDPIDGTSNFIKQI-PHVCVSIGLAINKQIVVGVINNPVQKKLFTTKLGQGAFC------- 148

  Fly   219 EYLSNLHPQHSPN-------NQAPIITVSRSHTAGAKDLARGIF--GENVSLLTAAGAGY-KVLQ 273
                |..|.|..:       |.|..:::...|:...|.:.| |:  |.|...|.|..... ::..
  Fly   149 ----NGKPIHVSSCESVKDANVAYEVSLLHVHSVANKHIKR-IYHVGLNARRLVAYSCVVDELCM 208

  Fly   274 VVANNATAYLHTSKIKKWDICAGD--------AILHALGGTMTTLNDQLINYGPEESPVNTEGLL 330
            |.|.|..|: :...:..||..||.        .:.|..||....:...||..|.|:.....|.||
  Fly   209 VAAGNLDAF-YIEDMYPWDCAAGSLLVKEAGGVVTHPFGGPFDIMKPDLICAGTEKLRKEIEDLL 272

  Fly   331 ATLEQHD 337
            ...:|.:
  Fly   273 RKGDQEE 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 58/267 (22%)
CG17027NP_001261909.1 IMPase 12..259 CDD:238817 52/245 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.