DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and INPP1

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001122400.1 Gene:INPP1 / 3628 HGNCID:6071 Length:399 Species:Homo sapiens


Alignment Length:395 Identity:103/395 - (26%)
Similarity:159/395 - (40%) Gaps:124/395 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LRKMLIAAIQAAQRGGLEVLDVARS-RQ--------LKERSKGKTDEGVNDPF-TDADGRSHCVM 111
            ||::|..:.:||        ::||: ||        ::|:.:|:.::.....| |.||.....|:
Human     5 LRELLCVSEKAA--------NIARACRQQEALFQLLIEEKKEGEKNKKFAVDFKTLADVLVQEVI 61

  Fly   112 KQGLQRIFPRVQ--IFSEEDKEH------------C-----------KQAHGYDLD----PTVLH 147
            ||.::..||.::  ||.||..|.            |           |..:|..:.    ..|:|
Human    62 KQNMENKFPGLEKNIFGEESNEFTNDWGEKITLRLCSTEEETAELLSKVLNGNKVASEALARVVH 126

  Fly   148 ETAQIPDVTVNAQDVTV-------WVDPLDATKEFTEELYEYV--------------TTMVCVAV 191
            :.....|.|:::.::.|       ||||:|:|       |:|:              ..:.||.:
Human   127 QDVAFTDPTLDSTEINVPQDILGIWVDPIDST-------YQYIKGSADIKSNQGIFPCGLQCVTI 184

  Fly   192 --------AGRPIIGVIHSPF----------NGQTAW--AWVGNSMSEYL--------SNLHPQH 228
                    .|.|::|||:.||          .||..|  :::|.:|....        |..|..:
Human   185 LIGVYDIQTGVPLMGVINQPFVSRDPNTLRWKGQCYWGLSYMGTNMHSLQLTISRRNGSETHTGN 249

  Fly   229 -------SPNNQAPIITVSRSHTAGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTS 286
                   ||:..| :|:.|...|..|. |:| :.|:.:  ..|||||||.|.||......|:.:.
Human   250 TGSEAAFSPSFSA-VISTSEKETIKAA-LSR-VCGDRI--FGAAGAGYKSLCVVQGLVDIYIFSE 309

  Fly   287 KIK-KWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGL-LATLEQHDEYMDKLSKYREA 349
            ... |||.||..|||.|:||.:..|.:.|     |.:|  ..|| |..|..|.|........|.|
Human   310 DTTFKWDSCAAHAILRAMGGGIVDLKECL-----ERNP--ETGLDLPQLVYHVENEGAAGVDRWA 367

  Fly   350 HNGKL 354
            :.|.|
Human   368 NKGGL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 97/379 (26%)
INPP1NP_001122400.1 IPPase 4..387 CDD:238818 103/395 (26%)
Substrate binding. /evidence=ECO:0000250 155..158 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.