DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and Inpp1

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001012131.1 Gene:Inpp1 / 316376 RGDID:1306071 Length:396 Species:Rattus norvegicus


Alignment Length:404 Identity:96/404 - (23%)
Similarity:155/404 - (38%) Gaps:142/404 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 MLIAAIQAAQRGGLEVLDVARS-RQ-------LKERSKG--KTDEGVNDPFTDADGRSHCVMKQG 114
            :|:..::.:::..    ::||: ||       |.|..||  |..:...|..|.||.....|:||.
  Rat     4 ILLELLRVSEKAA----NIARACRQQEALFQLLIEEKKGAEKNKKFAADFKTLADVLVQEVIKQN 64

  Fly   115 LQRIFPRV--QIFSEEDKEHCK---QAHGYDLDPT------------------------VLHETA 150
            ::..||.:  ::|.||..|...   :....:|..|                        |:||..
  Rat    65 MENKFPGLGKKVFGEESNEFTNDLGEKITVELQSTEKETAELLSRVLNGNMLASEALAKVVHEDV 129

  Fly   151 QIPDVTVNAQDVT-------VWVDPLDATKEFTEELYEYV--------------TTMVCVAV--- 191
            .:.|.|:.:.:::       :||||:|:|       |:|:              :.:.||.:   
  Rat   130 DLTDPTLESLEISIPQEILGIWVDPIDST-------YQYIKGSANVKSNQGVFPSGLQCVTILIG 187

  Fly   192 -----AGRPIIGVIHSPF----------NGQTAW--AWVGN-----------SMSEYLSNLHPQH 228
                 .|.|::|||:.||          .||..|  :::||           |.||..:....:.
  Rat   188 VYDLQTGLPLMGVINQPFASQNLTTLRWTGQCYWGLSYMGNNIHSLQLAISKSNSETQTENSDRE 252

  Fly   229 SPNNQAPIITVSRSHT--AGAKDLARGIFGENVSLLTAAGAGYKVLQVVANNATAYLHTSKIK-K 290
            |.|..:.:|:.|...|  ....|:..|      |:..|||||||.|.||...|..|:.:.... |
  Rat   253 SSNPFSAVISTSEKDTIKTALSDVCGG------SVFPAAGAGYKSLCVVQGLADIYIFSEDTTYK 311

  Fly   291 WDICAGDAILHALGGTMTTLNDQLINYGPEESP------------------------VNTEGLLA 331
            ||.||..|||.|:||.:..:.:.|     |.||                        .|..||:|
  Rat   312 WDSCAAHAILRAMGGGIVDMKECL-----ERSPDTGLDLPQLLYHVENKGASGVDLWANKGGLIA 371

  Fly   332 TLEQH--DEYMDKL 343
            ...::  |.::.:|
  Rat   372 YRSRNRLDTFLSRL 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 95/401 (24%)
Inpp1NP_001012131.1 IPPase 4..384 CDD:238818 95/401 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.