DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and Bpnt2

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_808398.1 Gene:Bpnt2 / 242291 MGIID:1915720 Length:356 Species:Mus musculus


Alignment Length:355 Identity:150/355 - (42%)
Similarity:198/355 - (55%) Gaps:34/355 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IRINRLPATIVAILLTFVLVYFLNFHQEERPAIYGMLRSE----------NPSRVNLRKMLIAAI 65
            ||::.|...:..:|...||.:..:.....|.:::| |.||          :...|:||:||..|:
Mouse     6 IRLSPLGVAVFFLLGLGVLYHLYSGFLAGRFSLFG-LGSEPAAGEAEVASDGGTVDLREMLAVAV 69

  Fly    66 QAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQRIFPRVQIFSEE-- 128
            .||:|||.||..|..|..|.|:|||||.||.:|..|..|..|:..|...|:..||.|||.:||  
Mouse    70 LAAERGGDEVRRVRESNVLHEKSKGKTREGADDKMTSGDVLSNRKMFYLLKTAFPNVQINTEEHV 134

  Fly   129 ---DKEHCKQAHGYDLDPTVLHETAQIPDVTVNAQDVTVWVDPLDATKEFTEELYEYVTTMVCVA 190
               |||..  .....:...:|.|.|...:|.  |:.||||:||||||:|:||:|.:|||||||||
Mouse   135 DASDKEVI--VWNRKIPEDILKEIAAPKEVP--AESVTVWIDPLDATQEYTEDLRKYVTTMVCVA 195

  Fly   191 VAGRPIIGVIHSPFNGQTAWAWVGNSMSEYLSNLHPQHSPNNQAPIITVSRSHTAGAKDLARGIF 255
            |.|:|::||||.||:..||||.|...     ||:..:.|.|.:.|.|.|||||....|.:|...|
Mouse   196 VNGKPVLGVIHKPFSEYTAWAMVDGG-----SNVKARSSYNEKTPKIIVSRSHAGMVKQVALQTF 255

  Fly   256 GENVSLLTAAGAGYKVL------QVVANNATAYLHTSKIKKWDICAGDAILHALGGTMTTLNDQL 314
            |...|::.|.|||||||      .:....|..|:|.:.|||||||||:|||.||||.|||||.:.
Mouse   256 GNQTSIIPAGGAGYKVLALLDVPDMTQEKADLYIHVTYIKKWDICAGNAILKALGGHMTTLNGEE 320

  Fly   315 INYGPEESPVNTEGLLATLE-QHDEYMDKL 343
            |:|...:....  ||||::. .|...:.||
Mouse   321 ISYTGSDGIEG--GLLASIRMNHQALVRKL 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 134/294 (46%)
Bpnt2NP_808398.1 IPPase 64..347 CDD:238818 134/293 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..104 11/19 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 219 1.000 Domainoid score I2633
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9852
Inparanoid 1 1.050 222 1.000 Inparanoid score I3532
Isobase 1 0.950 - 0 Normalized mean entropy S3073
OMA 1 1.010 - - QHG48614
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 1 1.000 - - FOG0007321
OrthoInspector 1 1.000 - - oto92036
orthoMCL 1 0.900 - - OOG6_107724
Panther 1 1.100 - - LDO PTHR43028
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4434
SonicParanoid 1 1.000 - - X5433
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.820

Return to query results.
Submit another query.