DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and Bpnt1

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001334139.1 Gene:Bpnt1 / 23827 MGIID:1338800 Length:323 Species:Mus musculus


Alignment Length:332 Identity:95/332 - (28%)
Similarity:143/332 - (43%) Gaps:71/332 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SRVNLRKMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEGVNDPFTDADGRSHCVMKQGLQR 117
            |...|.:::.:|...||:.|..|..|.....|....|    ....|..|.||......:...|.|
Mouse     4 SHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQK----TSATDLQTKADRLVQMSICSSLAR 64

  Fly   118 IFPRVQIFSEEDKEHCKQAHGYDLDP----TVLHETAQIPDV----------TVNAQDVTVWVDP 168
            .||::.|..||           ||.|    ..|.|..|..::          .:..:|:.|||||
Mouse    65 KFPKLTIIGEE-----------DLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDP 118

  Fly   169 LDATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN-------------------------GQT 208
            ||.|||:||.|.:.||.::.:|..|:.|.|:|:.|:.                         |:|
Mouse   119 LDGTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQNNEKEKLREHGNEAQAGPDAALGRT 183

  Fly   209 AWAWVGNSMSEYLSNLHPQHSPNNQAP----IITVSRSHTAG-AKDLARGIFGENVSLLTAAGAG 268
            .|..:|  :..:...|       .:||    |||.:|||:.. ..|....:..:.|  |...|||
Mouse   184 IWGVLG--LGAFGFQL-------KEAPAGKHIITTTRSHSNQLVTDCISAMNPDTV--LRVGGAG 237

  Fly   269 YKVLQVVANNATAYLHTSK-IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLAT 332
            .|::|::...|:||:..|. .||||.||.:.||||:||.:|.::...:.|..|...:|:.|:||.
Mouse   238 NKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAA 302

  Fly   333 LEQHDEY 339
            |..::.|
Mouse   303 LRNYEYY 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 93/326 (29%)
Bpnt1NP_001334139.1 IPPase 11..311 CDD:238818 93/325 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.