DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15743 and BPNT1

DIOPT Version :9

Sequence 1:NP_001259511.1 Gene:CG15743 / 32279 FlyBaseID:FBgn0030465 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_005273055.1 Gene:BPNT1 / 10380 HGNCID:1096 Length:323 Species:Homo sapiens


Alignment Length:336 Identity:96/336 - (28%)
Similarity:153/336 - (45%) Gaps:71/336 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 SRVNLRKMLIAAIQAAQRGGLEVLDVARSRQLKERSKGKTDEG-VNDPFTDADGRSHCVMKQGLQ 116
            |...|.:::.:|...||:.|:.|     .|.:.|...|..::. ..|..|.||..:...:...|.
Human     4 SNTVLMRLVASAYSIAQKAGMIV-----RRVIAEGDLGIVEKTCATDLQTKADRLAQMSICSSLA 63

  Fly   117 RIFPRVQIFSEED--KEHCKQAHGYDLDPTVLHETAQIPDV----------TVNAQDVTVWVDPL 169
            |.||::.|..|||  .|...|.         |.|.:|..::          .:..:|:.||||||
Human    64 RKFPKLTIIGEEDLPSEEVDQE---------LIEDSQWEEILKQPCPSQYSAIKEEDLVVWVDPL 119

  Fly   170 DATKEFTEELYEYVTTMVCVAVAGRPIIGVIHSPFN-------------------------GQTA 209
            |.|||:||.|.:.||.::.:|..|:.|.|||:.|:.                         |:|.
Human   120 DGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYENNEKQQLREHRNEAKAGPDAVLGRTI 184

  Fly   210 WAWV-----GNSMSEYLSNLHPQHSPNNQAPIITVSRSHTAGAKDLARGIFGENV-SLLTAAGAG 268
            |..:     |..:.|..:..|          |||.:|||:  .|.:...:...|. ::|...|||
Human   185 WGVLGLGAFGFQLKEVPAGKH----------IITTTRSHS--NKLVTDCVAAMNPDAVLRVGGAG 237

  Fly   269 YKVLQVVANNATAYLHTSK-IKKWDICAGDAILHALGGTMTTLNDQLINYGPEESPVNTEGLLAT 332
            .|::|::...|:||:..|. .||||.||.:.||||:||.:|.::..::.|..:...:|:.|:|||
Human   238 NKIIQLIEGKASAYVFASPGCKKWDTCAPEVILHAVGGKLTDIHGNVLQYHKDVKHMNSAGVLAT 302

  Fly   333 LEQHDEYMDKL 343
            |..:|.|..::
Human   303 LRNYDYYASRV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15743NP_001259511.1 IPPase 59..342 CDD:238818 94/327 (29%)
BPNT1XP_005273055.1 IPPase 11..312 CDD:238818 94/326 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1096950at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.