DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and Hdac3

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_445900.2 Gene:Hdac3 / 84578 RGDID:619977 Length:428 Species:Rattus norvegicus


Alignment Length:423 Identity:99/423 - (23%)
Similarity:169/423 - (39%) Gaps:96/423 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 TTGLAYDPLMLKHSCICGD---NAQHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTV 899
            |....|||.:       |:   .|.||....||....:.:....|.|:....:..:|:|.::...
  Rat     4 TVAYFYDPDV-------GNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCRF 61

  Fly   900 HTEAHAMLFGSNQCQLSRPKLENTLSASFVR-LSCGGLGVDLDT-----TWNEHHTATAARMAA- 957
            |:|.:....         .::..|....|.: |:...:|.|...     .:...:|..:.:.|. 
  Rat    62 HSEDYIDFL---------QRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQ 117

  Fly   958 --GCVIDLALKTAKGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRILIV 1020
              ..:.|:|:..|.|            .|||:...|.|||:.|.|.|....|.:..|   |:|.:
  Rat   118 LNNKICDIAINWAGG------------LHHAKKFEASGFCYVNDIVIGILELLKYHP---RVLYI 167

  Fly  1021 DWDVHHGNGTQQAFYQSPDILYLSIHRHDDGN-FFPGTGGPTECGSGAGLGFNVNISWSGALNPP 1084
            |.|:|||:|.|:|||.:..::.:|.|::  || ||||||...|.|:.:|..:.:|:    .|...
  Rat   168 DIDIHHGDGVQEAFYLTDRVMTVSFHKY--GNYFFPGTGDMYEVGAESGRYYCLNV----PLRDG 226

  Fly  1085 LGDAEYIAAFRTVVMPIARSFNPDIVLVSSGFDAATGHPAPLGGYHVSPACFGFMTR------EL 1143
            :.|..|...|:.|:..:...:.|..:::..|.|:       ||...:  .||....|      |.
  Rat   227 IDDQSYKHLFQPVISQVVDFYQPTCIVLQCGADS-------LGCDRL--GCFNLSIRGHGECVEY 282

  Fly  1144 LQLANGKVVLALEGGYDL--AAICDSAQECVRALLGDPAA--------------------PIAKA 1186
            ::..|..:::...|||.:  .|.|.:.:   .:||.:.|.                    |....
  Rat   283 VKSFNIPLLVLGGGGYTVRNVARCWTYE---TSLLVEEAISEELPYSEYFEYFAPDFTLHPDVST 344

  Fly  1187 ELERPPCQNAINTLQKTIAIQQTHWPCVRMLEH 1219
            .:|.   ||:...|.:   |:||.:..::||.|
  Rat   345 RIEN---QNSRQYLDQ---IRQTIFENLKMLNH 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 96/413 (23%)
Hdac3NP_445900.2 HDAC3 3..383 CDD:212529 99/423 (23%)
Histone deacetylase 3..316 87/360 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 388..428
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.