DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HDAC4 and HDA08

DIOPT Version :9

Sequence 1:NP_001259507.1 Gene:HDAC4 / 32278 FlyBaseID:FBgn0041210 Length:1269 Species:Drosophila melanogaster
Sequence 2:NP_563817.1 Gene:HDA08 / 837366 AraportID:AT1G08460 Length:377 Species:Arabidopsis thaliana


Alignment Length:432 Identity:112/432 - (25%)
Similarity:182/432 - (42%) Gaps:119/432 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   847 MLKHSCICG--DNA----------QHPEHSGRLQSVWARLNETDLVKRCDRLRARKATQEELQTV 899
            ||:|..:.|  |..          :|||::.|::::.:.|....:....:......|...||...
plant    14 MLRHDAVEGVFDTGYDPGFLDVLEKHPENADRVRNMLSILRRGPIAPHVNWFTGLPAIVSELLMF 78

  Fly   900 HTEAHAMLF-----GSNQCQLSRPKLENTLSASFVRLSCGGLGVDLDTTWNEHHTATAARMAAGC 959
            ||..:....     ...:|:::        :.:|  :|.|        :|.      ||.:|||.
plant    79 HTSEYIEKLVEADKSGERCEIA--------AGTF--MSPG--------SWE------AALLAAGT 119

  Fly   960 -------VIDLALKTAKGDLRNGFAVVRPPGHHAEANLAMGFCFFNSIAIAAKLLRQRMPEVRRI 1017
                   ::|...|.|       :|:|||||||::...|.|:||.|:.|:|.| |........|:
plant   120 TLSAMQHILDCHGKIA-------YALVRPPGHHSQPTQADGYCFLNNAALAVK-LALNSGSCSRV 176

  Fly  1018 LIVDWDVHHGNGTQQAFYQSPDILYLSIHRHDD--GNFFPGTGGPTECGSGAGLGFNVNISWSGA 1080
            .::|.|||:||||.:.||.|..:|.:|:|.:..  |:..|..|...|.|...|||:|:|:     
plant   177 AVIDIDVHYGNGTAEGFYTSDKVLTVSLHMNHGSWGSSHPQKGSIDELGEDVGLGYNLNV----- 236

  Fly  1081 LNPPL----GDAEYIAAFRTVVMPIARSFNPDIVLV-----SSGFDAATGHPAPLGGYHVSPACF 1136
               ||    ||..|..|...:|:|..|.|.||:|::     ||.||........:.||       
plant   237 ---PLPNGTGDRGYEYAMNELVVPAVRRFGPDMVVLVVGQDSSAFDPNGRQSLTMNGY------- 291

  Fly  1137 GFMTRELLQL--------ANGKVVLALEGGYDLAAICDSAQECVRALLGDPAAPIAKAELERPPC 1193
                |.:.|:        ::|::::..||||.:.    .|..|:.|:| :....|.:..|..|  
plant   292 ----RRIGQIMRGVAEEHSHGRLLMVQEGGYHVT----YAAYCLHAML-EGVLKIPEPHLSDP-- 345

  Fly  1194 QNAINTLQKTIAIQQTHWPCVRMLEHTVGLSALETLKVEHDE 1235
                      ||    ::|    .|....::|:|::|..|.|
plant   346 ----------IA----YYP----EEEANAVAAVESIKTYHTE 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HDAC4NP_001259507.1 iSH2_PI3K_IA_R 43..>87 CDD:304922
HDAC_classIIa 837..1211 CDD:212544 105/406 (26%)
HDA08NP_563817.1 HDAC_classII_1 6..351 CDD:212521 106/412 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0123
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1484694at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48252
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.